Conserved Protein Domain Family
DUF2484

?
pfam10658: DUF2484 
Protein of unknown function (DUF2484)
A role of this family in UDP-N-acetylenolpyruvoylglucosamine reductase, as MurB, could not be confirmed.
Statistics
?
PSSM-Id: 402340
View PSSM: pfam10658
Aligned: 12 rows
Threshold Bit Score: 57.3696
Threshold Setting Gi: 529580409
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q163J2                     1 MSLSLTLAALWAVLANVLAMLPSRdHHWRTAYMLIAVGIPIVGYVTAQHGPWVGMLILAAGMSVLRWPVIYLGR 74  Roseobact...
rhodo:RCAP_rcc00821        1 MTLSLATACLWAVIASLIALGPRR-FHWPAAWGLIAAGVPILGWVTYENGPVWGLAVLAGGLSVLRWPVRRLFA 73  Rhodobact...
jgi:Dshi_2421              5 fpLSLTLFCVWILVAAVIAVLPSR-YHWRGAFVLMALLVPLLGYIWAQLGPWYLLGAAVAAVSVLRWPVRYAMG 77  Dinoroseo...
WP_014879526               1 -mLSLLAAIIWVFVATGVAALPLR-WQRGPGIALLAAAPVLIYLLGRDHGWFAAAFGTFALVSMFRRPLLHVLS 72  Phaeobact...
Q28NN8                     1 MSLALTLACLWVLASAIVAMLPLR-FHWRFGLPLLILSIPLTIFVGYAHGWIWTVVILLAVGSMYRNPLRYFLK 73  Jannaschi...
Q1GIU9                     2 MNISLILACIWILVANVLALIPSRdNHWTRAYVLIAIGIPLLGYVTYENGPWWGLAMLVAGMSILRWPVIYLLR 75  Ruegeria ...
WP_014874083               1 MTLSLILACLWVVAANVLAMVPSRdNHWSRAYLLIAAGIPLVGYVTYENGPWWGLGVLFAGMSMLRWPVIYLGR 74  Phaeobact...
DSMZRoselon:roselon_03438  1 MPIAFILACLWALSACLAGMMPTR-YHWPAAWALIATGIPLLGFVTLSMGPWWGLALMAAGISVLRWPLIRLAQ 73  Roseibact...
Q3J4M0                     1 MVAPLLLAGLWVVAAMAVHHLPAR-VHWLGLALLILAGIPLLGWVTYRHGPFLGMFALILGAASLYWPVGRFGG 73  Rhodobact...
PRJNA212980:JCM7686_0683  11 aeaAWLMAVLWAIAASLVPFLRLH-WRLTAFWVVVGFGVPALGWLTFVCGPGAGGLVFLLGLGVLVWQPFARWR 83  Paracoccu...
WP_011750718               8 PATAAFCAVLWGVMACLLPFVRLR-WRHSMLWTLVFFGVPVLGWLTYLCGPGFGVLFLALGLSLLVWPPFETRR 80  Paracoccu...
Q28NN9                     1 MPGSLILACLWALVACCAGMAPRR-VHIPAAWVLILTGIPLLGWVTYQAGPVWGVFLLLAGMSVLRWPLIRAGQ 73  Jannaschi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap