Conserved Protein Domain Family
TMEM234

?
pfam10639: TMEM234 
Putative transmembrane family 234
TMEM234 is a family of putative inner membrane proteins. Many bacterial members are annotated as putative L-Ara4N-phosphoundecaprenol flippase subunit ArnE, and as inner membrane proteins. They may be transporters of the multi-drug-resistant superfamily.
Statistics
?
PSSM-Id: 371174
View PSSM: pfam10639
Aligned: 15 rows
Threshold Bit Score: 115.459
Threshold Setting Gi: 121966071
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0U0B5        22 FLMVGACWGLTTPFMRRAAMNYTPIPRPslTdpSnSWLKKKVlgiwyavsgVLSRPAYAVPLLLNVTGSVWFFILIGKAE 101 Parastagonospor...
EDO37684      12 LLGVALLWGVTNPFIKKGSAGIEDVKGKgaI--RqFLAEIRY---------LIFNWKYMVPFLLNQSGSVLFYLTLGSAD 80  starlet sea ane...
NP_001230081  10 LLLVAILWGGTNPFLKKGTEGIEEVQKKnkLl-Q-FLAELKF---------LFLNFKYLVPFLLNQSGSLVFYFTLASTD 78  zebrafish
Q5RBQ9        11 LVLVAALWGGTQPLLKRASAALQRVREP--TwvRqLLQEMQT---------LFLNTEYLMPFLLNQCGSLLYYLTLASTD 79  Sumatran orangutan
CAG10452      95 LLLVSVLWGCSNPLLKRGTQGLETVAETsrVs-Q-LFAEIKF---------LFLNFRYLIPFLLNQCGSLVYYYTLSSTE 163 spotted green p...
A0C2W3         7 LLVVGIIWGITNPFMESGVGNKQQD-----------LFGFKSfi------qTILNYKFIIPFGINQSASIFYYYLLGHTP 69  Paramecium tetr...
Q22BW6        16 LILVGIMWGITNPLMEMGSKTQNLEQ---------FDISLKFfl------sIFTRIAFLLPFIVNQLASVLFNILLGKAP 80  Tetrahymena the...
ANY27796       8 LLAVGLLWGVTNPFIRLGSQGIESVGDTgsKw-RnFVQEART---------IGSRWRYWIPFGLNQCGSALYVWTLQRAS 77  fruit fly
A0NGI1        20 ILLVAIMWGATNPFIKRGSIGYNELKADskLg-Q-LWLEVRF---------LITRWQYLLPLVINQLGSIVYVLTLQRTE 88  African malaria...
Q179X3        11 IVVVALLWGATNPFIRRGSLGYNNLKAPtkCg-Q-LWLEVKF---------LVSRWQYLLPLALNQLGSVVYVFALQRTE 79  yellow fever mo...
Q0U0B5       102 LSLTVPITNSLAFMFTVLGEWWAEKKVISRDTWIGMGFVLGGIALCV 148 Parastagonospora nodorum SN15
EDO37684      81 LSLAVPITNSLTFIMTTLTGRILGEESCKTETYIGMLLVVGGVSLCV 127 starlet sea anemone
NP_001230081  79 LSLAVPVVNSLTFLFTLLMGKVLGEEFGGKGAIMGMLLIMCGVTVCV 125 zebrafish
Q5RBQ9        80 LTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCI 126 Sumatran orangutan
CAG10452     164 LSFAVPVANALSFLCTLLTGKLLGEEFGGKKAVVGMFLTMAGITLCV 210 spotted green pufferfish
A0C2W3        70 LSLGPVIVNCVNSATTVITESRLKKQQLKQKTWIGLILIFIGTYLVC 116 Paramecium tetraurelia
Q22BW6        81 LTTAQAIANSCSSVVTLATESIIKKKPITIKTVLGIAFVTFGIYLCV 127 Tetrahymena thermophila SB210
ANY27796      78 ITVAVPVANSLSFAFTAITGYALGEKLPGRKVILGTLLVCCGSILMi 124 fruit fly
A0NGI1        89 LSLTVPMANSLTFVFTAITARLLGERQSGWKIYCGMTLVILGTVICG 135 African malaria mosquito
Q179X3        80 LSLIVPMANSLTFVFTVITARLLGEQGGSWKTYTGMILVIAGTVLCS 126 yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap