Conserved Protein Domain Family
CotE

?
pfam10628: CotE 
Outer spore coat protein E (CotE)
CotE is a morphogenic protein that is required for the assembly of the outer coat of the endospore and spore resistance to lysozyme. CotE also regulates the expression of cotA, cotB, cotC and other genes encoding spore outer coat proteins. The timing of cotE expression has been shown in Bacillus subtilis to affect spore coat morphology but not lysozyme resistance.
Statistics
?
PSSM-Id: 402319
View PSSM: pfam10628
Aligned: 19 rows
Threshold Bit Score: 273.798
Threshold Setting Gi: 226095913
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8EQR2                 7 EYREIITKAVCGKGRKFTKESHTISPSHRPTSILGCWVINHLYHATKKSEdSVVVTGSYDINVWYSYNDNTKTEVVTERV 86  Oceanob...
WP_013058796           4 HYREIITKAVVGKGRKFTQSSHTLAPKNRPTSILGCWVINHEYKAKKSGS-NVEVDGRYDINIWYSYNNNTKTEVWTETV 82  Bacillus
BAH44355               9 qCRELIAKAVCGKGHKFSITTHTIIPSQTPSTILGCWVINTNFQAEKVGD-AVEVSGTYDVNLWFSFANNTQTEVKRETV 87  Breviba...
zhongguo:PM3016_3132   8 qCREIYTKAVCGKGRKFSQVTNTVTPPHAPTSILGAWIINNQYDAVKSGE-NVEVVGTYDINIWYSYDRNTKTDVAKETV 86  Paeniba...
jgi:Theco_1763         9 kCREIITKAVCGKGRKFSTVSHTVTPPHRPTSILGAWIINHQYEAVRSGD-GIEVIGTYDINIWYSYNRNSETDVAKETI 87  Thermob...
ADO56952               7 NRREIITKAICGKGRRFSTVTHTVTPPNNPTSILGAWIINHQYEAVAAGD-GIEVIGTYDINIWYSYDKNSQTDVAKETV 85  Paeniba...
WP_015844200           9 qgREIITKAVCGKGRKFSTVSHTVTPPHHPTSILGAWVINHQYEAVRSGD-GIEVIGTYDLNIWYSYSKNSQTDVAKETV 87  Paeniba...
WP_013489009           9 NYREIITKAVCGKGRKFSQASHAITPAQQPTSILGCWIINHKYEAAKKGD-AIEVRGKYDINIWYSYSNNTKTDVATETV 87  Bacillu...
ADC51943               9 MYREIITKAVCGKGRKFSEATHKIKPAHKPSSILGCWIINHKYGAQKKGS-NVEVDGSYDVNLWFSYNDNTKTEVATQTV 87  Bacillu...
Q9KAB9                 6 NYREIITKAVCGKGRKFSQASHKISPSEKPSSILGCWIINHKYSADKKGE-NVEVQGSYDINVWFSYKNNTKTDVATQTV 84  Bacillu...
Q8EQR2                87 EYKDTIPLSVKDDNcINDEYDVIAKVLQQPNCLECKISGKGSNITVEIEREFVVQVIGDTRLFVKVSPKLDHDDDDEEsv 166 Oceanob...
WP_013058796          83 SYKDNIKLRYKDEDsIGDDYEVIVRVLQQPNCLECTISPNGNKTIVQVERELLAEVIGETKVCVAVNPKGCDDEDEFDl- 161 Bacillus
BAH44355              88 HFSVLVPLTFFDKN-CRGDLEIVARAVEQPKCIKAELS-GGGTITVRVESEYAVEVIGETKVCVVV----CNSCDDKEfh 161 Breviba...
zhongguo:PM3016_3132  87 SYAEVVPLHYLDKKhKPGTAEVSAVATQEPNCVEASISSSGSSVVLRVEREYKVEMLAETKVCVVV-CGSCDDYDDKHve 165 Paeniba...
jgi:Theco_1763        88 SYSELVPLSYIDPKhRASTEEVSAVATQEPSCVEANISASGADVVVRVEREFAVEMIAETKVCVAVCPGGCGDEDKAYd- 166 Thermob...
ADO56952              86 SYVENVPLSYLDPKhRASTVEVSAEATQEPSCVEASVSSGGGSVMIRVEREFAVELVAETKIVVEVFPYGSSDDFDKDfd 165 Paeniba...
WP_015844200          88 HYVEHVPLSYLDPKhRSSTEEVSADCIQEPNCIEANISTSGSGVVVRVEREYAVEMIAETKVWVACFPGGYDDGKELEf- 166 Paeniba...
WP_013489009          88 TYTDVVPLAMQDKNvVSDQLEVVARAVQQPNTLEATIASNGTGVDVQVEREFLVEVIGETKVCVYVNPDGVSDDWDEKvw 167 Bacillu...
ADC51943              88 NYTDVIPLSMQDQNvLSDDMEVFARALQQPNTLEASISENGEHVNVEVEREFVVDCIGETKMAVAVNPDGVIDEFDVEdd 167 Bacillu...
Q9KAB9                85 SYTDIIPLTMRDENvLSKEMDVVARPIQQPNTLEATIAESGVHVDVQVEREFVVECIGETKVAVAVNPDGIIEEIPESte 164 Bacillu...
Q8EQR2               167 w--dhNMTDDEAEKVKPDFFNH 186 Oceanobacillus iheyensis
WP_013058796         162 -----DVDDDEFEDLDPDFILG 178 Bacillus
BAH44355             162 lvddfEDNSDEFDDFDSATLLD 183 Brevibacillus brevis NBRC 100599
zhongguo:PM3016_3132 166 ----fGGDDGDYEDLDPDLLDE 183 Paenibacillus mucilaginosus 3016
jgi:Theco_1763       167 -----GYDDGGYEDLDPELLDD 183 Thermobacillus composti KWC4
ADO56952             166 ----fGAEEGDYEELDPDLIDD 183 Paenibacillus polymyxa SC2
WP_015844200         167 -----GLGDGDYEDLDPDLLDD 183 Paenibacillus sp. JDR-2
WP_013489009         168 ---dyDVEDEDFEDLDPNFLMG 186 Bacillus cellulosilyticus
ADC51943             168 e--fdDISDEEYEKLDPNFLHK 187 Bacillus pseudofirmus OF4
Q9KAB9               165 ---elELTEDEFEDLDPNFLQG 183 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap