Conserved Protein Domain Family
PilI

?
pfam10623: PilI 
Plasmid conjugative transfer protein PilI
The thin pilus of plasmid R64 belongs to the type IV family and is required for liquid matings. pilI is one of 14 genes that have been identified as being involved in biogenesis of the R64 thin pilus.
Statistics
?
PSSM-Id: 151143
Aligned: 2 rows
Threshold Bit Score: 140.969
Created: 23-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q933W7         1 MSAE---KFSVVIYTNTCEKKVSYIPATEDINIAIMPFQTADNGLIIVCQNSRIIRRKERIPGSSCEWKDVTFAPKSRNR 77  Escherichia coli
WP_074430621  16 MPQQhpgRLQILVVDAHCKRRLFSTKTPTDPDELARRFCTPDNCLVVVLRDNRFLFRLERAPGSHCRWHKGSSSRHQHLQ 95  Escherichia coli
Q933W7        78 VQL 80  Escherichia coli
WP_074430621  96 DWL 98  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap