Conserved Protein Domain Family
PilI

?
pfam10623: PilI 
Plasmid conjugative transfer protein PilI
The thin pilus of plasmid R64 belongs to the type IV family and is required for liquid matings. pilI is one of 14 genes that have been identified as being involved in biogenesis of the R64 thin pilus.
Statistics
?
PSSM-Id: 151143
Aligned: 2 rows
Threshold Bit Score: 140.969
Threshold Setting Gi: 75406080
Created: 27-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q933W7        1 MSAE---KFSVVIYTNTCEKKVSYIPATEDINIAIMPFQTADNGLIIVCQNSRIIRRKERIPGSSCEWKDVTFAPKSRNR 77  Escherichia coli
1_pfamImport  1 MPQQhpgRLQILVVDAHCKRRLFSTKTPTDPDELARRFCTPDNCLVVVLRDNRFLFRLERAPGSHCRWHKGSSSRHQHLQ 80 
1_pfamImport  1 MPQQhpgRLQILVVDAHCKRRLFSTKTPTDPDELARRFCTPDNCLVVVLRDNRFLFRLERAPGSHCRWHKGSSSRHQHLQ 80 
Q933W7       78 VQL 80  Escherichia coli
1_pfamImport 81 DWL 83 
1_pfamImport 81 DWL 83 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap