Conserved Protein Domain Family
DUF2474

?
pfam10617: DUF2474 
Protein of unknown function (DUF2474)
This family of short proteins has no known function.
Statistics
?
PSSM-Id: 402313
View PSSM: pfam10617
Aligned: 28 rows
Threshold Bit Score: 27.6445
Threshold Setting Gi: 381378528
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014341632    10 KPFWKRVVWLIIIYTLSVLSLAVVAFLFRMMMTAAGMKS 48  Rahnella aquatilis
KFC99776        15 APFLKRVGWMAVIWGGSVLALFVVASVFHLLMFAAGMRS 53  Rahnella aquatilis CIP 78.65 = ATCC 33071
CAR44694        20 ARWYQQIGWMIIIWSLSVLSLAIIASLFKLLMYSAGMRT 58  Proteus mirabilis HI4320
jgi:Gdia_1474    2 PPWTRRLGWMAVIWTASVLALGVFAMLMHLLMAAAGMag 40  Gluconacetobacter diazotrophicus PA1 5
wugsc:KPN_01932  3 TAWPKRLLWLIALWGGSVLTLAAISLLFRLLMTAAGLKv 41  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
CCH:MU9_1968    20 aPWWKKAAWMVAIWAGSVLALFAVSSLFRLLMTAAGMKv 58  Morganella morganii subsp. morganii KT
WP_012988574    13 PSLWKRLGWLVTIWLGSVLTLYAVSALFRVLMTTAGMKv 51  Xenorhabdus bovienii
CAR43023        14 PSLLKKWGWLITIWFCSVLALFAVSSLFRFLMTAAGMKv 52  Proteus mirabilis HI4320
CAX58754        13 PRAWKRVLWMVAIYAGSVMALGVVAMLFRVMMTAAGMKS 51  Erwinia billingiae Eb661
Q4KA98           9 ASTWQRLLWMGGIWLASVVGLGLVAGVLRLLMQAAGMHS 47  Pseudomonas protegens Pf-5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap