5DTB


Conserved Protein Domain Family
Lig_chan-Glu_bd

?
pfam10613: Lig_chan-Glu_bd 
Click on image for an interactive view with Cn3D
Ligated ion channel L-glutamate- and glycine-binding site
This region, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and it binds L-glutamate and glycine. It is found in association with Lig_chan, pfam00060.
Statistics
?
PSSM-Id: 402309
View PSSM: pfam10613
Aligned: 108 rows
Threshold Bit Score: 104.135
Threshold Setting Gi: 321472555
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5DTB_A                7 KTLVVtTIL-SNPYCMRke-sA--IPLSGN-DQ--FEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKL-TgeWNGMI 78   fruit fly
WGS:AADE:GA28121-PA 403 RFFRI-GTAeSMPWSYLrrneKtgELLRDRkGEpiWEGYCIDFIQRLSQKLNFEYEIVAPQTGHMGEMNDE-Ke-WDGVV 479  Drosoph...
XP_002585883        396 KVLRI-ISKeRDPWVRLkq-hAdtEGLKGV-ER--YEGFLIDMLNLMAKRLNFTFTIDVRDNITIGSQSET-DgsWDGMI 469  Florida...
EFX71622             79 KRIRL-TSYeDPPFVIl------eRDSNGTiAS--YQGFIYEMIHALQQLYNFTYEVTIPSVGTYGQETWN-Gt-WDGMM 147  common ...
EFX79318              9 RHFRI-GTIhAPPYIIi-------EHTGRNiSH--VNGFVHQIVAWLAEKHQFTFEYVGPPDGAYGAFVNG-S--WNGMV 75   common ...
EFX83525             40 LHLRI-ASLdVRPY----------MSIEKNqSTyrADGIVYQIIVWLSIRYNFTFSLVLPPDGTFGALVNH-T--WNGMI 105  common ...
EFN61837            310 TNYRV-VTIqHAPFMM----------YNNKtNR--WYGFCIDLLDAIRETVPFEYEVREVEDGQYGALNEN-Gs-WDGII 374  Florida...
EFX86214            416 SVFKI-AVVvQAPFIMk-------RKANGT-VT--FYGYCVDLIKDIQAIMGFEYELYEVPDGKYGNMDSKmN--WNGMI 482  common ...
XP_008200796        423 VVYRV-VTVeQKPFII--------KDETAP-KG--YKGYCIDLIQRISEILNFDYEITPVGDQKFGNMDEN-Gk-WNGVV 488  red flo...
XP_021207886        437 LVYRV-VTVeQQPFII-----RddNAPKG------FKGYCIDLIEEIRQIVKFDYEVTLSPDGNFGTMDEN-Gn-WNGII 502  domesti...
5DTB_A               79 RELLEQRADLAIADLTITFEREQAVDFTTPFMNL-GVSILYRK 120  fruit fly
WGS:AADE:GA28121-PA 480 GDLVRGETDIAIAALKMYSEREEVIDFLPPYYEQtGISIVIRK 522  Drosophila pseudoobscura pseudoobscura
XP_002585883        470 GLLARREYDLALDAVSTRSFRLKAVDFTEPIEMA-GYYLIMRR 511  Florida lancelet
EFX71622            148 GLIVNQRVEIGVGPFSITHSRAKAVDFTVGFYED-AAAILIPP 189  common water flea
EFX79318             76 GMVIAGEIDIIAASLSVTYPRSQVVDFTFAFSED-PTSILIPY 117  common water flea
EFX83525            106 GMAINNQVEIIAAPVVPSLDRAKVLDFTTTFSEE-PMICLIPA 147  common water flea
EFN61837            375 RELVDKRADIGLGSIWVMAEREKVVDFTVPYYDLvGLTIMMLK 417  Florida carpenter ant
EFX86214            483 KELMEKRADIGLGALAVMAERENVIDFTVPYYDLvGISILMAK 525  common water flea
XP_008200796        489 RELMEKRADIGLGSMSVMAERENVIDFTVPYYDLvGITILMKL 531  red flour beetle
XP_021207886        503 KELIEKRADIALTSLSVMAERENVVDFTVPYYDLvGITIMMKL 545  domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap