4I43


Conserved Protein Domain Family
RRM_4

?
pfam10598: RRM_4 
RNA recognition motif of the spliceosomal PrP8
The large RNA-protein complex of the spliceosome catalyzes pre-mRNA splicing. One of the most conserved core proteins is PrP8 which occupies a central position in the catalytic core of the spliceosome, and has been implicated in several crucial molecular rearrangements that occur there, and has recently come under the spotlight for its role in the inherited human disease, Retinitis Pigmentosa. The RNA-recognition motif of PrP8 is highly conserved and provides a possible RNA binding centre for the 5-prime SS, BP, or 3-prime SS of pre-mRNA which are known to contact with Prp8. The most conserved regions of an RRM are defined as the RNP1 and RNP2 sequences. Recognition of RNA targets can also be modulated by a number of other factors, most notably the two loops beta1-alpha1, beta2-beta3 and the amino acid residues C-terminal to the RNP2 domain.
Statistics
?
PSSM-Id: 402298
View PSSM: pfam10598
Aligned: 35 rows
Threshold Bit Score: 122.735
Threshold Setting Gi: 56470178
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4I43_B        211 KIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPAN 290 
CAM43611     1059 NVDWTFFRPMLELIMDKSLVDYIVSRHDVVVEFKDMSYHHYKGLIRGFMFSPFLAQYWGLVMDVLLLGTQRSKEIAGTAV 1138 Leishmania br...
Q6CCC5       1010 KIDFTFLQYLLRLIMDENLAKYIIAKNNVRLTYKDMSHTNNYGLLRGLQFSSFVVQYYGLVADLLILGLTRASQMAGDPK 1089 Yarrowia lipo...
XP_001330664  968 QIDLTFLNYMLRLVVDHNLADYMTSKNNVKISFKDMSYLNGVGLIHGLQFTSFIAQYMGLLVDLLILGLRRANEMCGPPS 1047 Trichomonas v...
XP_003676084 1082 KIDFTLLNRLLRLIMDQNIADYMTAKNNVALNYKDMSHVNKYGLLRGLQFSSFIYQYYGLVMDLLILGPDRASDLAGPPT 1161 Naumovozyma c...
Q75D15       1052 KMDFTLVNRLLRLVMDPNLADYITAKNNVSITFKDMSHVNKYGLIRGLQFASFVYQYYGLMMDLLILGPERAHELAGPPD 1131 Eremothecium ...
Q6CXV6       1061 KMDLTLINRLLRLIIDPTLADYITAKNNVSLIFKDMNHVNKYGLIRGLQFAPFVYQFYGLMIDILILGHERAQELAGPPN 1140 Kluyveromyces...
CCE61602     1070 KIDFTLLNRLLRLIMDPNMADYMTAKNNIILNFKDMSYVNKYGLIRGIQFASFIYQYYGLVLDLLILGIDRANELAGTLT 1149 Tetrapisispor...
Q6FQZ4       1061 KVDFTLLNRLLRLVMDPNLADYMVAKNNVIVNFKDMSYVNKYGIIRGLQFASFLYQFYGLVMDILILGIDRANEIAGPVS 1140 [Candida] gla...
CCH59614     1081 KIDFTLMNRLLRLVLDPNLADYMMSKNNVIINFKDMSHINKYGLIKGIEFTSFIYQYYGLVIDLLILGLERATDIAGSPS 1160 Tetrapisispor...
4I43_B        291 NPNEFMQFKS 300 
CAM43611     1139 KPNPFMSFFR 1148 Leishmania braziliensis MHOM/BR/75/M2904
Q6CCC5       1090 RPNYFMQYPS 1099 Yarrowia lipolytica
XP_001330664 1048 MPNSLFQFAS 1057 Trichomonas vaginalis G3
XP_003676084 1162 MPNEFMHFKS 1171 Naumovozyma castellii CBS 4309
Q75D15       1132 APNEFLQFKN 1141 Eremothecium gossypii
Q6CXV6       1141 EPSEFLQFPD 1150 Kluyveromyces lactis
CCE61602     1150 ERNEFMQFKN 1159 Tetrapisispora phaffii CBS 4417
Q6FQZ4       1141 APNEFMEYSS 1150 [Candida] glabrata
CCH59614     1161 SPNDFLQFKS 1170 Tetrapisispora blattae CBS 6284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap