Conserved Protein Domain Family
Synapsin_N

?
pfam10581: Synapsin_N 
Synapsin N-terminal
This highly conserved domain of synapsin proteins has a serine at position 9 or 10 which is a phosphorylation site. The domain appears to be the part of the molecule that binds to calmodulin.
Statistics
?
PSSM-Id: 402285
View PSSM: pfam10581
Aligned: 2 rows
Threshold Bit Score: 72.7049
Threshold Setting Gi: 1774920177
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KPP64551    35 MNYLRRRLSDSNFMSNLPNGYMSDLQRPDPPQ 66  Asian bonytongue
KAE8612786   1 MQFLKRRLSDSGFLGSLPSGYLSDLGRPEPPP 32  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap