Conserved Protein Domain Family
UPF0560

?
pfam10577: UPF0560 
Uncharacterized protein family UPF0560
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402282
View PSSM: pfam10577
Aligned: 16 rows
Threshold Bit Score: 941.099
Threshold Setting Gi: 47217628
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002193851  33 VTLKVHVSDASTHQPVTEAFIEIFTNQISIASGTSGADGTAFLKFQYKLGNQLIVTASKHAYVPNSAPWKPVRLPVFSSL 112 zebra finch
5_pfamImport   1 VTLKVHLSDASTHQPLGGATVQLFTNHTPVTTETSTPDGNAYLRFPYRLGTQLVVTATKQGYVPNSVPWTPSRLPVFSSI 80 
A2A699        41 ILIKVQVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASV 120 house mouse
OCA20547      43 VHIKVQVYENGDLSPLASAAVEIFGNQSALASGVTDQDGIAVLGISYRLGTWVLVTATKRGYVTNSVPWRVDRLPLYASV 122 tropical clawed...
XP_015217836  35 VFIRVQVFDNSDLSPLARAAVEVYGNQSTLASGVAGDDGAVAVRFQYRPGTWVIVTASRQGFVTNSAPWHASRIPLYASV 114 spotted gar
XP_684281     35 VLIKVQVFDNSDLSPLRESTVQVCGNQTILASNLVGEDGIVTLTFLYRPGTWVIVTASKHGFVTNSAPWHASRVPLYASV 114 zebrafish
XP_001337555  34 VQVRVQVFDGGDLSPLPNAALAVHGNQSLLAQSRAGSDGVQVVSFTYRTGTWVIITASQRDYLTSSVPWHASRLPLYASV 113 zebrafish
XP_005992281  37 VLIKVQVFDNSDLSPLFHASVDVYGNQSSLASGITDGDGVVTITFQYRPGTWIIVTAAKYGFVTNSAPWHVDRIPMYASV 116 coelacanth
CAG11910       2 VTLKVHLSDASTRQPLSGVTVQLFANHTSVTTETTSADGNTYLRFPYRLGTPSVVVATKRGYVPNSVPWTPSRLPVFSSV 81  spotted green p...
XP_001335931  39 VVLKVHLSDSSTHQPLSGVTVEVFTNHTPVSSDVSGADGNAFIRFPYRLVDLLVVTATKRGYVPNSVPWRPSRLPVFSSL 118 zebrafish
XP_002193851 113 SLGLLPERSATLMVYDDVVQIVSGFQGARTQPQVHFQRRSVKLPENTSYSELTAYLTAASSPWEVDSFPYLQGLDGNGT- 191 zebra finch
5_pfamImport  81 SLDLLPERAATLMVYEDIVEIVSGLQGLRPQPRVDFQRGALTLPSNISYANLTALLTVASSPSHIQYFPHLQVLSGNGTa 160
A2A699       121 SLYLLPERPATLILYEDLVHILLGSPGARSQPWVQFQRRAARLPVSSTYSQLWASLTPASTQQEMRAFPAFLGTEASSS- 199 house mouse
OCA20547     123 SLYLVPERPATLILYEDIVQILLGSPGVRSQPWVQFQRKAARLPRSSTYNQLTSSLTTASNLHQMRGFPSFIGTEPESSn 202 tropical clawed...
XP_015217836 115 SLYLLPQRPATLILYDDVVQVLLGSPGARNQPWVQFQRKAVRLPLNSTYTELSAVLTSAKSQYEIGGFPYLLGQESNGTg 194 spotted gar
XP_684281    115 SLYLLPQRPATLLLYDDVVQLLLGSPGSRRQPWVQLQRRAIQPPLNNSQITLSAMLTSSRSQYELGGFPYPLAMDNNSTg 194 zebrafish
XP_001337555 114 SLYLMAQKPGTLILYDDVIQVFHGSPSGRSQPWLQVPRRSLQF--NSSYTELTAVLTTAREQNEINSFPYPLALEPNNTg 191 zebrafish
XP_005992281 117 SLYLLPERPATLILYEDVVQILLGSPGSRNQPWVQFQRKAVRLPENSTYSHLSAFLTAASSEYEIGGFPYLVGLESNGT- 195 coelacanth
CAG11910      82 SLDLLPERTATLMVYEEVVEIVSGIQGFRHPPIVNFPRRALTLPFDTSYANLTALLTVAGSPSHIQHFPHLQAVDSNSS- 160 spotted green p...
XP_001335931 119 SLDLLPERAATLMVYEDVVEIVSGFQGPKLQPRVQFQRRALSLPSNATYTNLTAFLTVSSSTQDTQYFPYLQGLHPNFT- 197 zebrafish
XP_002193851 192 -GNSTRYDLTPVTAVSVHLLSSDGTPVPVNGPIYVTVPLPAN-SNLKHNAHVPAWRFDQKFGTWLKSSLGIVQQEGNQLT 269 zebra finch
5_pfamImport 161 -GTEERFELTPVAAISVHLLAGDGVELQVNGAITVSVPLPAN-SGLKENDHIPAWRFDPRLGAWIKSSWCHVQRDGNRLS 238
A2A699       200 -GNGSWLELIPLAAVSVHLLTGNGTEVPLSGPIHLSLPVPSEpRALAVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLY 278 house mouse
OCA20547     203 gGNTSWVELLPVAAVSVHLFTGNGSEVHLSGPVQLSLPLPPE-SGLTTSSSVPAWRYEPKAGLWIRSGMGMVRRDGQQLY 281 tropical clawed...
XP_015217836 195 -GNGSWLDLTAVAAVSAHLFTRNGTLIQVSDPVHISIPMPSD-SPVRVATSIPAWRFDSKTGVWVRNGTGYIKKEGAQLT 272 spotted gar
XP_684281    195 -TNSSWVELTALAAMCAQLTGPNGTEVQVSEPIHISIPLPSD-SPLKTATSVPVWRFEDKTGLWVRSGAGYIKKEDTQMT 272 zebrafish
XP_001337555 192 -GENGWTDLTTIAAVSAQLFDREGRAVEVSEPVHISVPLPSD-THIRSASSIPVWMYDTKTGLWVRNGTGFIIREGSQLR 269 zebrafish
XP_005992281 196 -GNSSWLELTPVAAVSVHLFIGNRSEVQLSAPVHVSIPLPGD-SPLLATTNVPAWRFHPKSGIWVRSGTGQIKREGTQLT 273 coelacanth
CAG11910     161 -GTEKRLELTPVAAVSVHLLASDGAQLQVNRPITVSLPLPAD-GDLKENDAVPVWRFDPLLGAWLKSGWGHVRREGNQLI 238 spotted green p...
XP_001335931 198 -GSERKFELTPIAALSVHLLGSDGVELHVSEPISVSVPLPAN-SGLKENDHIPAWRFDPKLGAWLKSSLGYVQREGKQLT 275 zebrafish
XP_002193851 270 WTYIAPQLGYWVAAMSPTVPGPVVT----HDITSYHTMFLLAILGGMALILLVLLCLLLYYCRRKCLRPRQHHKKLQLST 345 zebra finch
5_pfamImport 239 LTYIAPQLGYWVAAMSPIHSGPVFA----KDISMYHTVFLLAILGGMALILLCLLCLLLYYCRRRCLKPRGSHRKLTLSS 314
A2A699       279 WTFVSPQLGYWVAAMASPTSGLVTItsgiQDIGTYHTIFLLTILAALALLVLILLCLLIYYCRRRCLKPRQQHRKLQLSG 358 house mouse
OCA20547     282 WSFVSPKLGYWAAAIPSSGRGMLSLms-gvDIAGYHTIFLLSILGALALLVLILLCLLIYYCRRRCLKPRQQHHKLQLSG 360 tropical clawed...
XP_015217836 273 WSFVAPQLGYWIAAVPSATGGMALNpsglRDITTYHTIFLLTILGSMALLVLILLCLLLYYCRRRCLKPRQQHRKMHISS 352 spotted gar
XP_684281    273 WSFVAPKLGYWLAAFPS-TSGSGLNtsglRDITTYHTIFLLAILGAMALLVLILLCLLLYYCRRRCLKPRQHRRKMHLSS 351 zebrafish
XP_001337555 270 WDFTASQLGYWIAAFRA-SSGSGLShpglRDITAYHTFFLLSILGSLALLVLVLLCVLLYYCRRRCLKPRRQQKQVQVPS 348 zebrafish
XP_005992281 274 WNYVASQLGYWMAALPSSMAGGAMGppglRDITTYHTIFLLTILGALALLVLILLCLLLYYCRRRCLKPRQQHRKLQISN 353 coelacanth
CAG11910     239 LTYIAPQLGYWLAAMSPIHSGLVFA----KDMNSYHTVFLLAILGGMALILLCLLCLLLYYCRRRCLKPQMSHRKLTLAS 314 spotted green p...
XP_001335931 276 LTYIAPQLGYWVAAMSPINTGPVVA----KDISTYHTVFLLVILGGMALILLFLLCLLLYYCRRKCTRLRPAHRKFTLSS 351 zebrafish
XP_002193851 346 ALDTSKKDQATSMSHINlifsrresefpgglsvasnghaensgakeLISAVHMEMVSPTGEADMHTP-MLKHSFSTSQEF 424 zebra finch
5_pfamImport 315 GLDGNRRDQATSMSHMNlisekvc---------------vcysctrCTLQVQLELVSTATEPDMTTP-MLNPSSYEHQDN 378
A2A699       359 -PSDNKRDQATSMSQLH-----------------------------LICGGPLEP-TSSGDPEAPPPgSLHSAFSSSRDL 407 house mouse
OCA20547     361 -LSEPKRDQATSTSHIN-----------------------------LISTSHLDS-SSTADSDLRTP-VLRSAF------ 402 tropical clawed...
XP_015217836 353 TLDSSKKDQGTSTSHIN-----------------------------LISSSHIETASSNGDMDANTP-VMKSAFSSSREF 402 spotted gar
XP_684281    352 TLESSKRDQGTSTSHLN-----------------------------LISGGHMETASSTGDLN----------------- 385 zebrafish
XP_001337555 349 ALNGSRKDQGTSTSHLN-----------------------------LICGGHVESAASNGNLDANKS-----EGSPSHAF 394 zebrafish
XP_005992281 354 TLDSSKKDQGTSTSHIN-----------------------------LISSSHIESASSNGDMDVHTP-VLKSTYSNSRDL 403 coelacanth
CAG11910     315 SLD--KKDQATSMSHLNlis------------------------------neLELVSTATEADMTTP-MLKPFSYEHRDN 361 spotted green p...
XP_001335931 352 ALDGSKRDQATSMSHLN-----------------------------LINETHLDQ--NGAEPDMHTP-MLKPTP-----Y 394 zebrafish
XP_002193851 425 SSREELLSDKE-KDKSRISLDD----------LTPSGslRKDYHKSADSFPLKTRKSTEtAEGYESPI-KDEYRRSYNAM 492 zebra finch
5_pfamImport 379 HRQHSLIHHGK---HSRSSLGNshhgs-slgnLTPRS---RDYLHSVETFQLKPALSCGtERGC---------RQSYTSA 442
A2A699       408 ASSRDDFFRAKpRSASRPAAEP-------------------PGARTVEGAGLKSARSVEgPGGLEPSL--DEYRRGPA-- 464 house mouse
OCA20547     403 -SSREDFCKSGgRSSLQHSADT-----------------LPLRPGSRDEYTLKSARSGD-------LLeCEDLKRGYG-- 455 tropical clawed...
XP_015217836 403 QSSREEFFKQIpAQKGRHSKFNtd-------tIT---------RRGVESFQMKVARSAEvP----------------NNL 450 spotted gar
XP_684281    386 -SSRDDFFKHGpTQRQHNSRTN-------------------ADSKRGESFPLKATRSSNt--GTRDLLlQDDYGKGYS-- 441 zebrafish
XP_001337555 395 KSARDEFTRHIpAHKLRHSSKNk---------------qSKGAQRNPESFPMKVHQSTDtSNLDSNLL-HENYGRNYS-- 456 zebrafish
XP_005992281 404 essreeffkqLpSQKKRYTKAStd-------tLTHRVgaKDEYQRPVESFQLKVARSVDvSGALEPPM-LDDYKQSYSSM 475 coelacanth
CAG11910     362 RREPNIIHHTK---HSRSSLSNnshqgsslgnLTPRS---RDYRQSAETFQLKASLPAAaERGY---------RQSCTSV 426 spotted green p...
XP_001335931 395 DSSTNELATSRgELHSRGS---------------------NHYKHSVEIFPLKSACSNNpSEGYDSAAgRGEYRRSYTSI 453 zebrafish
XP_002193851 493 -LSqp--lfEKQEREIQvsm------nhIATGSKYNIQEQ-IYPTPS-----APEKE-L----LDCRPTDCM-MSRSVDH 551 zebra finch
5_pfamImport 443 cSS------SNPLSVSSnpasv--nhvaATHRSGVGIVDC-ISPSSPp---rSPSRAeG----CECRAPDYL-LSRSVDH 505
A2A699       465 -------------------------------GAAAFLHEP---PSPPp---sFD-HYlGhkgaAESKTPDFL-LSQSVDQ 505 house mouse
OCA20547     456 -------------TGGKgqq--------rrRGGRGGVRDP--PPSPPplpppFK-HViG-----DSKPPDYL-MTQSADP 505 tropical clawed...
XP_015217836 451 aGQq-----NVEDKSGEghr------rhVVNDNKAYSQDP---PSPPplpppFE-HYqGh--kVENKPPDFL-ISQSADH 512 spotted gar
XP_684281    442 ---------SAEDSDDRkyn------hhNAKDNQGYSSDP---PSPPpllppFAGHYqDl--nRDSKPPEYY--ASAGDH 499 zebrafish
XP_001337555 457 ----------SDDKDQDyrr------rhVVNDNRGYTSDP---PSPP----------------LVDKPPEYSqVLQGPDH 501 zebrafish
XP_005992281 476 vSQq-----TVEDKSTEthr------rhLMNESKSYNQAP---PSPPplpppFE-HYvGh--kMDNKPSDFM-MSQSVDQ 537 coelacanth
CAG11910     427 cSS------SNlnhg----------qasGTHLSSPGTVDC-MSPSSPp---hTPSRGeA----CEGRAPDYL-LSRSVDH 481 spotted green p...
XP_001335931 454 tTSsvhplhMSVSSSSPhtlhhttsagrLSSESKSSLRDQrLSPVSAaspagSPEREqG----IERRTTDYL-LSRSVDH 528 zebrafish
XP_002193851 552 LERPAS--F-PRPGQLICCNSVDQVN--DSVYRKVLPALVIPGHYMKLPGEHPFVSQPLV-----VPADQQIDIER-LQA 620 zebra finch
5_pfamImport 506 LERPSPplL-SRPGQLLCCGSVDLLSggDG-YPRVRPTLVIPAHYMRLPGEHPLSGQALL-----LQTDQQSDLET-IQA 577
A2A699       506 LARPPS--L-SQPGQLIFCGSIDHLK--DNVYRNVMPTLVIPAHYVRLGGEAGAAGVG----------DEATPPEG---- 566 house mouse
OCA20547     506 LSRPTS--L-TQPGQLIFCGSIDHMK--EGGYRHAMPTLVIPAHYVRLSSEENSGGQG----------EDQCESEC---G 567 tropical clawed...
XP_015217836 513 LARPTS--L-SHPGQLIFCGSIDQMK--DNMYRSVMPTLVIPAHYMRLSSDFSGMEHAMGmgldqQQQQHQQEMEG-I-- 584 spotted gar
XP_684281    500 LNRPSS--VnTQPGQLIFCHSMEQMK--ESMYHSMVPTLVIPAHYMHLSSDLTAVEQAME-----RQQQLQHDMEG---I 567 zebrafish
XP_001337555 502 LARPTS--LnTQPGQIIFCSSLDQMK--ENMYRTMVPTLVIPAHYMRFSSEFGGSDQG-------KDGTNQSDRDGqSSQ 570 zebrafish
XP_005992281 538 LARPTS--L-SQPGQLFFCGSIDHMK--ENMYRKVMPTLVIPAHYMRLTTDHYSKDQAVG-----IPPEQQQEMEG-ALG 606 coelacanth
CAG11910     482 LERPSLqpL-SRPGQLLCCGSVDLLSggDG-YPRVRPTLVIPAHYMRLPGEHPLSGQALL-----LQTEQQSDLET-IQA 553 spotted green p...
XP_001335931 529 LERPAP--L-PRPGALLCCTSELIVNkgEETYRKARPTLVIPAHYMRLPGTHPLSGQALL-----LQSDVQSELET-IQA 599 zebrafish
XP_002193851 621 ELPNPHARLFPHPAQQLQPQQLASQAISQQ-------HLQDAGAAEWSQ-QNASMSESISIPASLNDA-SL--AQMNSEV 689 zebra finch
5_pfamImport 578 ELNASHS----------------QQPLGQTptdcapcPSKPGEAERH------GLSESLSIPAALGETgGL--VEINSED 633
A2A699       567 --SAAGPARPFPQPDPQRPLMQGHAGAG----------GDSGGGEGWGGgRSAPVSGSVTIPVLFNES-TM--AQLNGEL 631 house mouse
OCA20547     568 STQVSHAHHFAPQDHAQRQQLLQQ---GHIyqqgtpgSVQDQEGKGWGN-HSSQMSGSVTIPVVFNES-TM--AQLNGEL 640 tropical clawed...
XP_015217836 585 HVNLSMPHQLTPQQQQQMQQQASQQN-------------EDPEGRGWGP-HPS--TGPVRIPVLFNDS-TM--NQMNGEL 645 spotted gar
XP_684281    568 QVSMTLPRQ-------QNQKQQQQQARADNeeeesgkQADGSSEENWGSdQS---SAPVRIPVLFNDS-TI--AQMNGEL 634 zebrafish
XP_001337555 571 GTSSGIQSQIHQGQTPGSGHTDGQQGA----------SPAGSDDSVW---PSSGTPAPVHIPVLFNDS-TI--SQMNGEL 634 zebrafish
XP_005992281 607 QAGMPMPHQFGPQEMHHYQHQHMQHSVQ---------QMEDPEGKGWS-------SQSVAIPVLFNES-TM--AQLNGEL 667 coelacanth
CAG11910     554 ELNASHP----------------QQAPGQTaegcspdPSKHADGEQL------GLSDSPAIPSALGDN-AL--VEINRED 608 spotted green p...
XP_001335931 600 ELSACHQPQ--GQVLHKGEQEGGTQGMG---------EDQGGGADEWTL-QTAALPADLSIPNSLSQA-GLdvVQMNGED 666 zebrafish
XP_002193851 690 QLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHVRHSYIDL-------------------QRAGRNGS----------- 739 zebra finch
5_pfamImport 634 TLWAEKTLMELRGGKPLPHPRAWFVSLDGRSNAHIRHSYIDL-------------------QRAGCHGS----------- 683
A2A699       632 QALTEKKLLEL-GVK--PHPRAWFVSLDGRSNSQVRHSYIDL-------------------QAGSGGRS----------- 678 house mouse
OCA20547     641 QALTEKKLLEL-GVK--PHPRAWFVSLDGRSNAQVRHSYIDL-------------------QAGDKTRS----------- 687 tropical clawed...
XP_015217836 646 QALTEKKLLEL-GVK--PHPRAWFVSLDGRSNSHVRHSYIDL-------------------QGGERVRS----------- 692 spotted gar
XP_684281    635 QAMTEKKLLEL-GVK--PHPRAWFVSLDGRSNSLVRHSYIEL--------------------------S----------- 674 zebrafish
XP_001337555 635 QALTEKKLLEL-GVK--QHPRAWFISLDGRANAHVRHSYIDVgadhghsgthsgnhsaqstLSAPAGSS----------- 700 zebrafish
XP_005992281 668 QALTEKKLLEL-GVK--PHPRAWFVSLDGRSNAQVRHSYIDL-------------------QTSEKNRS----------- 714 coelacanth
CAG11910     609 TLLAEKTLMELRGGKPLPHPRAWFVSLDGRSNAHIRHSYIDL-------------------QRAGCHGNassageardng 669 spotted green p...
XP_001335931 667 QLLAEKTLMELRGGKPLPHPRAWFVSLDGRSNAHIRHSYIDL-------------------QRAGCNSScv--------- 718 zebrafish
XP_002193851 740 -----------NDA----------SLD---SGVD--MNE--PKSARKG-------RGDHlsapqshppvQEHQQ-RER-K 782 zebra finch
5_pfamImport 684 -----------NDA----------SLD---SGVD--LNE--PRLGRRR-------RDGG----------REEREvDRSkG 718
A2A699       679 -----------TDA----------SLD---SGVD--VHE--ARPARRRl-----pREER-----------ERAQl----P 710 house mouse
OCA20547     688 -----------NDA----------SLD---SGVD--VNEikLKPGPEE-------RSGK-----------SQLQ------ 717 tropical clawed...
XP_015217836 693 -----------NDA----------SLD---SGVD--VNE--AKPHRRL-------KEDR-----------ERAG------ 720 spotted gar
XP_684281    675 -----------NEAlrppmgacnqTLDqrtEAIP--TNS--GKPSHRKlkedgkvKEGG-----------ERKA------ 722 zebrafish
XP_001337555 701 -----------KDR----------SID---ASLQdtQHDrkSASGRKT-------KEEHh--------gSSRKG-HGGsS 740 zebrafish
XP_005992281 715 -----------NDA----------SLD---SGVD--VNE--AKPTKKG-------KEER-----------ERHT------ 742 coelacanth
CAG11910     670 gaggggggrrgKDA----------SLD---SGVD--LNE--PRAGRRG-------RDGD----------REEREiDGSkV 715 spotted green p...
XP_001335931 719 ---------gsNDA----------SLD---SGVD--MSD--VTPGRRV-------RDKV----------VVKTE-PEAqP 754 zebrafish
XP_002193851 783 VSDSTAYTQLVYLDD--MDQSGSECGTA-VCS-----------------------------PEDNALRCLLEG------- 823 zebra finch
5_pfamImport 719 PALATAYTQLVYVDD--LERGGSEEEESpQCS-----------------------------PQDSKAGRVLSPeaegqrg 767
A2A699       711 APPPPAPPRLALSED--TEPSSSESRTg-LCS-----------------------------PEDNSLTPLLDEvvapegr 758 house mouse
OCA20547     718 -PSTLTYSKLVFAEE--GEQSLSESRTGgGCS-----------------------------PEDSSLTPLLDEgsetclp 765 tropical clawed...
XP_015217836 721 -PGSMAYSKLAYMDD--TEQSSSESRTa-MCS-----------------------------PEDNSLTPLLDEslesrga 767 spotted gar
XP_684281    723 --HGKIYSKLPVIE---TPDSSSESHSa-MYS-----------------------------PEENSTAPLLDEtaevskg 767 zebrafish
XP_001337555 741 FGGGKHYSKPAYHDP--LDLSGGVSRMg-ASS-----------------------------PLENPLTPLLDDgpeeprg 788 zebrafish
XP_005992281 743 -PGNIAYSKLAYMDD--TEQSSSESRTa-VCS-----------------------------PEENSLTPLLDEsvehrat 789 coelacanth
CAG11910     716 AAPAAAYTQLVYVDD--GDRGGSEEQVPkRES-----------------------------PQDSKTAlaeaq------- 757 spotted green p...
XP_001335931 755 AAPVVGHTPVLIVEDsnADEENSGSPTp-VCSpeesalkgllqekqseeddegtlsppsppPEIPSPPPLPEPvvetse- 832 zebrafish
XP_002193851 824 ------------TSKRSGvQLPSLQEETrtvdtkpePLTSPehgt----siqDDDDEDEEDEEDDQGEDKKSPWQKREER 887 zebra finch
5_pfamImport 768 -----dqgpgdvEGLQMHeEPPSLSSSSpas---ppPLPTPegetfrtghslLSVSPDDDAAQEDGEGEKKSPWQRREER 839
A2A699       759 aatvprgrgrsrGDSSRS--SASELRRD--------SLTSP-----------EDELGAEV---GDEAGDKKSPWQRREER 814 house mouse
OCA20547     766 m----grrgrsrGDSSRS--STSELRRD--------SMTSP-----------DEDLNDQSETGDDQ--DKKSPWQKREER 818 tropical clawed...
XP_015217836 768 t---iprkgrsrGNSSRS--SNSEIRRD--------SMTSP-----------EDEMNDQSGEGDDQGENKKSPWQKREER 823 spotted gar
XP_684281    768 gt--fprkgrsrDNSTRS--SASEVHRD--------SVTSP-----------DDDNDDK----DDDGENKKSPWQKREER 820 zebrafish
XP_001337555 789 ss--mprrgrsrGNSSRS--SNSETQRD--------SVTSP-----------EDDNDL-----DDKEENKKSPWQRIEER 840 zebrafish
XP_005992281 790 i----prrgrsrGNSSRS--SNSEIRRD--------SMTSP-----------EEEMNDQSEGADDQGENKKSPWQKREER 844 coelacanth
CAG11910     758 --------kgdvEGAQTV-ESPSRSSSSsspasppppps--------pevgarrtdhLTDAVQEDAEEEKKSPWQRREER 820 spotted green p...
XP_001335931 833 -------dtgidGEVFRTeETPVHMNSS------------R-----------PDKLLVPDDGGED--ENKKSPWQKREER 880 zebrafish
XP_002193851 888 PLMTFN 893 zebra finch
5_pfamImport 840 PLLSFN 845
A2A699       815 PLMVFN 820 house mouse
OCA20547     819 PLMVFN 824 tropical clawed frog
XP_015217836 824 PLMVFN 829 spotted gar
XP_684281    821 PLMVFN 826 zebrafish
XP_001337555 841 PLMVFH 846 zebrafish
XP_005992281 845 PLMVFN 850 coelacanth
CAG11910     821 PLLAFN 826 spotted green pufferfish
XP_001335931 881 PLLAFN 886 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap