Conserved Protein Domain Family
UPF0552

?
pfam10574: UPF0552 
Uncharacterized protein family UPF0552
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402280
View PSSM: pfam10574
Aligned: 14 rows
Threshold Bit Score: 323.551
Threshold Setting Gi: 765554577
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6DJ71         1 MSRIYHNTSLRNKPVHDERIAGSWEPTAFQRGAGVLLEGTLLDFSRHSLTDSKGKK------ERWYILYLMPSKIHRRHF 74  tropical clawed...
EKC28598       1 MSRIYDNKPLHNLPVINVDIPSIWDPNQYSSGDGVILEGNIKGRSRFSLTDKSHSKvpndyfFRYYILHTEVQRAHRRKF 80  Pacific oyster
XP_009023782   1 MSRIYSNDPLTALPVKNIFYDQVWNESDWHQGSGVILEASVKSRLRFSLIDKNQQK------IRYCAFVLLVRRAHRRVF 74  Helobdella robusta
EEN66649       1 MSRLYNNQPLLSIPVQTHQLTTAWQPEKHQKGSGVILEGVIEGRSRHVIIDTSQAK------FRYIVLHVRPSRAHRRKF 74  Florida lancelet
XP_787889      1 MSRIYDNKPLQSVPVQNQ--TGNWNPQQFQSGSGAILEGKIDSRSRHVITDSKQNK------SRYFVLHVRVKIAHRRQF 72  purple sea urchin
Q1LWJ6         1 MSRIYDNTALLNKPVHNEKLSFTWDPIVHQSGHGVILEGTVVDFSRHAITDVKNRK------ERYNVLYIKPSRVHRRKY 74  zebrafish
XP_013120719   1 MSRIYHNTSLQNKPVHSEKFDRAWCPSAFESGPGVLLEGKLLDVSRHAITDSNNQK------VRFYVLYIQPSRIHQRKF 74  Nile tilapia
Q17QU3         1 MSRIYQDSALRNKAVRSARLPGAWDPAAHQRGDGVLLEGELLDVSRHSILDAHGRK------ERYYVLYIRPSRIHRRKF 74  cattle
XP_001518005  12 qpfVYQDSALRNKAVHNVRFPGAWAPSTHQGGNGVLLEGTLADISRHAISDVHGRK------ERYYVLHVRPSRVHRRKF 85  platypus
XP_007479387   1 MSRIYHDSALRNKAVHSIRLPGSWDPAAYQRGNGILLEGELVDVSRHNISDANGKK------ERYYVLYLSASGVHRGEF 74  gray short-tail...
Q6DJ71        75 DSKGNEIEPNFSDTKKVNTGFLMSSYKVEAKGESDKISVEELIQLVNKVELMKISEKYTPRE---TVAFWLPEVDVEKTE 151 tropical clawed...
EKC28598      81 ESNGREIEPNFSETHKVRTGYLNSSYKVEPKGQTDKLSSDQVKDIVCHDDLTKITSPRLPKEctgCLSLWLQENEMEKME 160 Pacific oyster
XP_009023782  75 DGK-KEIEPNFSATEKVRTGFLHSSYKVVPKGQSDFLTYDELVKIIQPTNVLTVFGLDTNEKd-sFINVFLEENDLEKLE 152 Helobdella robusta
EEN66649      75 DSEGREVEPNFSDTWKVNTGYLHSSYKVEARGQTDRLSAAELEAAVTSAELSGLTQQVLRDG---CLPFWVGEEELAGME 151 Florida lancelet
XP_787889     73 NSKGEEIESNMDATQKVNTGYLMSSYKVEAKGQTDRLTQSQLSALVNKPSLTSLTQRHTPEG---CLAFWMTELELKDVE 149 purple sea urchin
Q1LWJ6        75 DSKGNEIEPNFSDTKKVNTGFLMSSYKVEAKGETDCLDERQLREIVNKEQLVKVTIKHCPRE---AFAFWISEAEMDKTE 151 zebrafish
XP_013120719  75 DANGKEVEPNFSDTKKVNTGFLMSSYKVEAKGESDRLSEEQLSAAVNKAELMKITDKHRPAG---TWAFWYPEADMEKTE 151 Nile tilapia
Q17QU3        75 DPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDSDRLTPEALKGLVNKPELLALTESLTPAE---TVAFWMPESEMEAME 151 cattle
XP_001518005  86 DPKGNEIEPNFSDTKKVNTGFLLSSFKVEAKGTTDRLSPVELKGLVEKPDLLELTKGHTPDQ---AVAFWILETDMEKME 162 platypus
XP_007479387  75 FCRRKEFESEFSSAVRVNCLFLLSRFFVEAKGDTDRLLPMELKGLVEKPELLVVTGSHTPDQ---TFAFWIPEAEIEKIE 151 gray short-tail...
Q6DJ71       152 LELGEQLRVKTMGDSPFVFSLAKVDSGTVTKCNFAGDAQAGASWTDNIMAQKSQSTSACfe-prGQGDGAEDDEW 225 tropical clawed frog
EKC28598     161 LEEGEMIRVKTSGNGPFICSITKMDAEAKTKGNYAGGENVGGSWTDKIMGMKSSQPADT-----SQTEGVDEDEW 230 Pacific oyster
XP_009023782 153 ISDKDEIRLKTKGNSPFLENLCKINALNSALSNYAGDDKIGASWTDKIMAVKQNLELQEee---------pnDEw 218 Helobdella robusta
EEN66649     152 LNSGDNVRLKTRGDGPFIYNIAQLDGATSQVSNFAGGDMVGSSWTEKVMAVKRDQEer----reEENQGVEEDEW 222 Florida lancelet
XP_787889    150 FEDGDVIMLRTKGDGPFIDSVGKLDTSSKEMTNMAGSGQLGESWTDKIMTIKSSQDPPNpkpgqEENEGAGDDEW 224 purple sea urchin
Q1LWJ6       152 LEPGQEVRLKTKGDGPFIFSFAKLDSGTVTKCNFAGDENAGASWTEKIMANKSNQENTGks--aAQGEGADDDEW 224 zebrafish
XP_013120719 152 LETGQDVRLKTRGNSPFVFSLAKIDGGTVTKCNFAGDDKAGASWTDKIMANKADTSSTQkp--gG-GEGAEEDEW 223 Nile tilapia
Q17QU3       152 LELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFAGDGKTGASWTDNIMAQKSSEGAASet--rEQGDGAADEEW 224 cattle
XP_001518005 163 LELGEEVRLKTRGDGPFIGSLAKVEAGTVTKCNFAGDREVGASWTDNIMAKKSSEGAVVep--rGLGDGAEEDEW 235 platypus
XP_007479387 152 LELGAEVRLKTQGDGPFIGSLAKLEAGTVTKCNFAGDGQTGASWTDNIMAQKSLEGTASei--rGQGDGAEDDEW 224 gray short-tailed op...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap