Conserved Protein Domain Family
UPF0565

?
pfam10561: UPF0565 
Uncharacterized protein family UPF0565
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402270
View PSSM: pfam10561
Aligned: 19 rows
Threshold Bit Score: 288.499
Threshold Setting Gi: 74873322
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001990233  21 RIFSVAGFQ-NRANDIVYCPPIVr-------------QQSQHVDDSKAIIYFGGDVQDFPE-------SMETNRDSRGYM 79  Drosophila grim...
XP_001614480   6 SVHNLAGYN-ERCNTVLYREPIR----------------TNKSYASKYIIFFPGDYSNFFTnsiytsfKLEATNECSDYC 68  malaria parasit...
O97301         6 STFKICGYN-EKYNTILYREPIL----------------TSEEYVKKYVIFFPGDYSYFFSnsvytsfKTQSTCECTNYC 68  Plasmodium falc...
OWR43671       5 RLRRVSGYE-GRVNDVIFRPAI-----------------SDAARGAETLVFFGGDVQDYPE-------AMQAHRDNRHYV 59  Danaus plexippu...
Q176R0        81 RINGIKGYQ-NRTNHIIYCPPLL-----------------RSKDDCSAVVYFGGDVQDIPE-------KMETNRDNKNYI 135 yellow fever mo...
XP_002073548  21 RIFSVAGFQ-NRTNDIVYCPPIVr-------------QQSQHVEDSTAIIYFGGDVQDFPE-------SMETNRDSRGYM 79  Drosophila will...
XP_001998976  21 RIFSVAGFQ-NRANDIVYCPPIVr-------------QQSQHVDDSKAIIYFGGDVQDFPE-------SMETNRDSRGYM 79  Drosophila moja...
XP_005989576  46 KLPAVVGSEsGRANDLLLVLPTAacprdlretdrappLQQQQQQQQHHVIYFPGDVQSYHD-------VMAYHSENFRWQ 118 coelacanth
XP_012825886  38 RLPAVPGCEaTKCNDVVLRPA------------------RESSQKPQHVVYFPGDVQNYRD-------VMASHPENFRWK 92  tropical clawed...
XP_311074     56 RINSVKGYQ-NRTNSIIYCPPLLr-------------GNSPK-EKCSAIVYFGGDVQDIPE-------KMESNRDNKNYI 113 Anopheles gambi...
XP_001990233  80 KYNLENSAILLREAFPRSHIIVIRPVRMEFKTFSCFDNFVRGNNAGVPDH------------------------------ 129 Drosophila grim...
XP_001614480  69 -YSYEALFWVLSSKYLYDHLVFIKPS-LFVNHFSSFSNFLNPSDVSLSGHghpvtvargtgh-------------vntgg 133 malaria parasit...
O97301        69 -YSYEALFWILSQRYLYDYILFIIPS-DFSNYFATFSNFLNPCDIPLDNNlyelnrenennydvlnmenkinkksvsfik 146 Plasmodium falc...
OWR43671      60 KWNLESTARMLGESFVDKHIVVVRPSRIEFKSFSCYDNFVPSNNAGVPDH------------------------------ 109 Danaus plexippu...
Q176R0       136 KWNLENTALLLRDSFPRAHIVVVRPMRMEYSTFSCFDNFVRGNNAGIPDH------------------------------ 185 yellow fever mo...
XP_002073548  80 KYNLENSAILLREAFPRSHIIVIRPVRMEFKTFSCFDNFVRGNNAGVPDH------------------------------ 129 Drosophila will...
XP_001998976  80 KYNLENSAILLREAFPRSHIIVIRPVRMEFKTFSCFDNFVRGNNAGVPDH------------------------------ 129 Drosophila moja...
XP_005989576 119 RWSLENVAIMLSLRFPNSYIWIVKSSRMHLHKFSCFDNFVESNLFGTPEY------------------------------ 168 coelacanth
XP_012825886  93 QWSLEDVADMLSQRFPYSYIWIIKSSRMHLHKFSCYDNFVESNMFGAPKH------------------------------ 142 tropical clawed...
XP_311074    114 KWNLENTALLLRESFPQSHIVVVRPMRMEYSTFSCFDNFVRGNNAGIPDH------------------------------ 163 Anopheles gambi...
XP_001990233 130 ------TPMNHALQHLEKLLQN---LSQRLIS-IPENEILDQAA-------QAAAAAAAVAAaAAAAALT---------- 182 Drosophila grim...
XP_001614480 134 tnpgdaVVPAKSVNHLLCLLLS---LDERLsgg----------------svGSGESGLNGDHtASVNGTP---------- 184 malaria parasit...
O97301       147 neyinsNIRAKSIKHLLCLLLS---LNNEVLHkDMLNEGNFHKIinnennyNDNNDNNNNDNsNNDNNNNyyyiccdkpl 223 Plasmodium falc...
OWR43671     110 ------TPTHHALLHLERLLKN---VSIRMKT-MSERELLdvlrdvspdssvegcrtavp-------------------- 159 Danaus plexippu...
Q176R0       186 ------TPMHFSLQHLEELLIN---LTKKLTKpVLEPDLLHKLI-------AATNSSLCetglegsqemdvdvlqsdiqn 249 yellow fever mo...
XP_002073548 130 ------TPMNHALQHLEKLLQN---LSQRLIS-IPENEILDQAA-------QAAAAAAAVAAaAAAAALT---------- 182 Drosophila will...
XP_001998976 130 ------TPMNHALQHLEKLLQN---LSQRLIS-IPENEILDQAA-------QAAAAAAAVAAaAAAAAMT---------- 182 Drosophila moja...
XP_005989576 169 ------STDFGAFKHLCALLTNackLAQNLLLsRRDVNRLNKAAdne--acNSNSVHTTNGCpPEED------------- 227 coelacanth
XP_012825886 143 ------STELGAFKHLQSLLTNafsAAQSLLVsQNNKYSVDRDYdls--kmDICPTYTTNGCpEKDNIIh---------- 204 tropical clawed...
XP_311074    164 ------TPMHYSLQHLEELLIN---LTKKLTKpILDQEFLHKLL-------SASSTKGyggdvpckqnnadilqsniydg 227 Anopheles gambi...
XP_001990233 183 ---LSNAT-VNSDTGPSSaavndssqemdidilqvqenvtvdadgavifpiisagltatgtttnnttpaadtvnngnnkd 258 Drosophila grim...
XP_001614480 185 ---CGDSNgEGTHTSAHGrsdhtdgp------------------------------------------------------ 207 malaria parasit...
O97301       224 inyLGNELkTEKNIYSKErknnif-------------------------------------------------------- 247 Plasmodium falc...
OWR43671         --------------------------------------------------------------------------------     Danaus plexippu...
Q176R0       250 ntanlas------------------------------------------------------------------------- 256 yellow fever mo...
XP_002073548 183 ---LSNATsVNTDSTSASltaassqaandnsqemdidilqvqenvtvdadgavifpivsgssnrinne------------ 247 Drosophila will...
XP_001998976 183 ---LSNAT-VNSESSSASvaaaaaaaaaaaaandssqemdidilqvqenvtvdadgavifpivsagstetstatnnggnv 258 Drosophila moja...
XP_005989576 228 ----GTCGhSEKPFCILGsadq---------------------------------------------------------- 245 coelacanth
XP_012825886 205 ---------STIYLGMPSlk------------------------------------------------------------ 215 tropical clawed...
XP_311074    228 gaa----------------------------------------------------------------------------- 230 Anopheles gambi...
XP_001990233 259 attnshqe--------------------------lnnqlqqqiaakatvsapannvehynninssidcaalqsslqtqpl 312 Drosophila grim...
XP_001614480     --------------------------------------------------------------------------------     malaria parasit...
O97301           --------------------------------------------------------------------------------     Plasmodium falc...
OWR43671         --------------------------------------------------------------------------------     Danaus plexippu...
Q176R0       257 -----------------------------------------------------------------------------ssv 259 yellow fever mo...
XP_002073548 248 -------------------------------------------------------casavpvlstlpaaaattaaaaava 272 Drosophila will...
XP_001998976 259 nnsnnkdallnnhqesniqqqqqqlqqqqqllqqqqqqpqqtvvkaasapmnnvdhynnttnssndcaadrqpslptqpq 338 Drosophila moja...
XP_005989576     --------------------------------------------------------------------------------     coelacanth
XP_012825886     --------------------------------------------------------------------------------     tropical clawed...
XP_311074    231 -------------------------------------------------------------------------------g 231 Anopheles gambi...
XP_001990233 313 qprpttptsennplwwrenlnldkSKLVLIGFSKGCVVLNQFIYEFHYLKTltpdDSSMCRLLSRITDMYWLDGGHGGQK 392 Drosophila grim...
XP_001614480 208 -----------------pplsplkRRLVLIGFSRGCSVLFALMREANEGQL----------LLPYVDSVYLLDPGFNKRL 260 malaria parasit...
O97301       248 ------------------mkniikNKLVLIGFSKGCSVLFSLLRESHEGPF----------FWSYVDSIIFLDPGFNKNI 299 Plasmodium falc...
OWR43671     160 ----repssardplwwreslaldeSSISLVGFSKGCVVLNQIIYEFHYTQTltpgDEHMMRLSGRICDMYWLDGGHAGGK 235 Danaus plexippu...
Q176R0       260 tgsgasntdindllwwreslnldkANLALMGFSKGCVVLNQFIYEFHYYKTltpdDSTMMRLVSRIKDMYWLDGGHGGGK 339 yellow fever mo...
XP_002073548 273 aqtprqatsdsnplwwrenlnldkSKLVLIGFSKGCVVLNQFIYEFHYLKTltpdDSSMCRLLSRITDMYWLDGGHGGQK 352 Drosophila will...
XP_001998976 339 qprpatptsennplwwrenlnldkSKLVLIGFSKGCVVLNQFIYEFHYLKTltpdDSSMCRLLSRITDMYWLDGGHGGQK 418 Drosophila moja...
XP_005989576 246 ---------------------yssVSFTLIGFSKGCVVLNQLLHELKVAKN----NKELATFIKNIKAMYWLDGGHSGGN 300 coelacanth
XP_012825886 216 ----------------------dsLSITVIGFSKGCVVLNQLLYELQEAIK----DKDIQSFLANIKAMYWLDGGHSGGC 269 tropical clawed...
XP_311074    232 aedpaepddlaellwwrenlnldkASLKLIGFSKGCVVLNQFIYEFHYYKTltpdDSTMMRLVSRISDMYWLDGGHGGGK 311 Anopheles gambi...
XP_001990233 393 NTWITSRSLLETLTRMGMNIHVHLTPYQVQDDRRPWIRKEEKLFTEMLRRLNAP 446 Drosophila grimshawi
XP_001614480 261 YNTEIESSALEKVAQCGLKIFLHSTPHQVTNKNDVHIHSELLNFLKKLRQHGVg 314 malaria parasite P. vivax
O97301       300 YNINIEKNALEKLSQHKLKISVHCTPNQIMDNTSMNIHEEYIHFVKILKDIHIY 353 Plasmodium falciparum 3D7
OWR43671     236 NTWLTARSLLETIATRGVNIYIHVSPYQIKDESRPWIGREEKIFSSLLKKLGAK 289 Danaus plexippus plexippus
Q176R0       340 NTWITSRSLLETLCRLGINVHVHVTPYQIQDDHRPWIRKEEKAFTDLLKRLGAC 393 yellow fever mosquito
XP_002073548 353 NTWITSRSLLETLTRMGMNIHVHLTPYQVQDDRRPWIRKEEKLFTEMLRRLNAP 406 Drosophila willistoni
XP_001998976 419 NTWITSRSLLETLTRMGMNIHVHLTPYQVQDDRRPWIRKEEKLFTEMLRRLNAP 472 Drosophila mojavensis
XP_005989576 301 DTWVTSQEVLRELAQLEVAVYTHVTPYQVHDTMRSWIGKEHRKFVRILRDFNME 354 coelacanth
XP_012825886 270 DTWITNPEILKAFALTGIAVHTHVTPYQVRDIMRSWIGEEHRKFVQLLKKYNVK 323 tropical clawed frog
XP_311074    312 NTWITSRSLLETLCRLCINVHVHVTPYQIQDDHRPWIRKEEKAFTDLLKRLGAA 365 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap