1U6G,1LDJ,2DO7,1IUY,3O6B,3DPL


Conserved Protein Domain Family
Cullin_Nedd8

?
pfam10557: Cullin_Nedd8 
Cullin protein neddylation domain
This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognizes and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.
Statistics
?
PSSM-Id: 402267
View PSSM: pfam10557
Aligned: 342 rows
Threshold Bit Score: 44.7422
Threshold Setting Gi: 123476926
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U6G_A       706 DRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKP-RVPVIKKCIDILIEKEYLERVD 766 
EMG47832     739 NRDEEFKSCVIKIMKQERELNIVNLLNQSIAMLERRQPV-NITNLKTIVENLIQMEFLKRDD 799  Candida maltosa Xu316
XP_002549970 767 NRDEEFKSCIVKLMKQEKQLDIHDLLNRSITFLQKKQSV-DFSRLKVIIEKLIETEYLKRDD 827  Candida tropicalis MYA-3404
XP_001527145 857 NRVEEYKSVLMRILKQESSLDVLDLLNRAIEILQARRPV-YVTQLNECLENLIEQEFLARSG 917  Lodderomyces elongisporus NRRL Y...
CCE40343     784 NRTEEFKSVIVRIMKQAKTLQMTNLLNQSIEILQKRRPV-SIIDLKAVIEKLITDEFLRRRN 844  Candida parapsilosis
CCE89009     714 NRDTEIKCILVRIMKQEKSVLYSDLIYQTLEHAQAKGPC-DVSDIKTQLDYLIANEFVKREP 774  Millerozyma farinosa CBS 7064
Q6BUS5       715 NRSVEFRSALVRVMKSAKRISYLDLLTQTLPLVEKNGPC-TIADLKSNLEYLIENEFVKREl 775  Debaryomyces hansenii
XP_002616492 706 NRDPEVRAALVRTMKQSKSILYAELLANVLHTMEQRGTSlSVHTVKEGIEYLISNEYIRRDA 767  Clavispora lusitaniae ATCC 42720
XP_006687167 691 NRDTEIRSVIVSIIKVDTKILFTDLINKAIETVSKKGPV-SIQDIKSNIEFLITKEYITRDT 751  Yamadazyma tenuis ATCC 10573
XP_001483430 682 NRNQEIRAAIVKTMKQCKNATVPQLFDAVFKLVAPKGPI-SLDDFNTNLDFLVQSQYVLREA 742  Meyerozyma guilliermondii ATCC 6260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap