Conserved Protein Domain Family
ORF6C

?
pfam10552: ORF6C 
ORF6C domain
This domain was identified by Iyer and colleagues.
Statistics
?
PSSM-Id: 402264
View PSSM: pfam10552
Aligned: 15 rows
Threshold Bit Score: 112.792
Threshold Setting Gi: 81584293
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q81A80               125 VLKLTFAALEGHTQQIQEIKSEVKGLR----ENTPLYAIECEEITRAVKSLGVMLLGGKNSNSYQDIGlrRKLYRDIYSQ 200 Bacillu...
Q8DXH4               115 AFIALFTGQKKLKEHQLALAQDVDYLK----NEQPIHPSFAQALLKKRKARVVSCLGGMDSPAYADKVfaQSVFRQAEVD 190 Strepto...
SKLIDPC::KE3_1417    121 AFIQLFQTQKEIKKEQAVMRDDIVYLK----EEQPVNPSINQDLTKERNKAVVKCLGGYDAPAYSDSKlrQKVFWQAAKD 196 Strepto...
Q9CGS9               123 QIALLAQGNVNLNKKVEQIENSVLDLT----DRFGLPSNKAKVLQKKVASKVYMFTGGKYSNAHKKLG--AKVFREFYKD 196 Lactoco...
Q81Z40               131 AIIYSMTELKQIKSRQDHTEEEMNKMKllvdNELWLTEQHKGSVQRKVKQRVFEL---------KKEGydNASYQGIYGA 201 Bacillu...
BAO08081             123 LILLALEGNEETNQRIDKIDERLVDIE----ENKLITTEDKGTIDRAVRKKVYQICKEQHLGQNAK----GMLYQDLGSS 194 Enteroc...
tigr:NT01CX2197      118 QLKLQYEVIEEHEEKLSSIETKVNKLE----NSMTIDYAQQEELSSLARKIVVQALGGKNTPAYKELN--KKAFSTLWRD 191 Clostri...
microsynth:EHR_00695 107 nTELLLETALKHERNLAAVNERLDKLE----TETIINSSQRRKIQGLVRSTVIKILGGKKSNAYKNKSinRAAFSNCYNQ 182 Enteroc...
Q833C7               113 NTELLLEAALKHERGLTLVNQRLDKLE----TETTINRSQQRKIQGLVSSTVIKVLGGKKTLAYQDSSikQSAFSNCYKQ 188 Enteroc...
WP_012103644         129 QLRLQYQVIEQHEEKINELDIKVESLA----LTMNISDGQAKTIQKLVNKRVKALCYGDESSAYMNTSirKKVYSYIWRT 204 Clostri...
Q81A80               201 LHREFGVNSYKAIKRYHLDRAIQMInEEYSIPTVLNEEI 239 Bacillus cereus ATCC 14579
Q8DXH4               191 FKDHFNINRYDMLPKKFAEAALSYW-MTWEPSTNTKMKI 228 Streptococcus agalactiae serogroup V
SKLIDPC::KE3_1417    197 FKELFKIPRYDLLKKKDIDRAYDYW-KQWQPQTNLRLEI 234 Streptococcus lutetiensis 033
Q9CGS9               197 LNNRFDVVKYSDIPLSRYDEATEYL-DMWQPSFNTTLEI 234 Lactococcus lactis subsp. lactis
Q81Z40               202 LKRHFGVAKYDKIPRKYYQNAMRFI-AGWYPPERPNTLD 239 Bacillus anthracis
BAO08081             195 IKQLFKVPNRGRIKDKDFRKVLNFI-NCWEPSSVTKERI 232 Enterococcus mundtii QU 25
tigr:NT01CX2197      192 FKRIMQVNSYKNTSVKQFYRAKDLI-NNWKPNRELELMI 229 Clostridium novyi NT
microsynth:EHR_00695 183 LKAVFDVASYMDIPKARFIEAIDLI-PKWKPDLELQARI 220 Enterococcus hirae ATCC 9790
Q833C7               189 LKALFDVASYVDIPKVRYEEAVALI-PRWKPNLELQARI 226 Enterococcus faecalis
WP_012103644         205 LKDYLNVTVYHNILRKDYSSALKYI-NAITLQGALLREV 242 Clostridium kluyveri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap