Conserved Protein Domain Family
P22_AR_C

?
pfam10548: P22_AR_C 
P22AR C-terminal domain
This domain was identified by Iyer and colleagues. It is found associated with pfam10547.
Statistics
?
PSSM-Id: 402261
View PSSM: pfam10548
Aligned: 7 rows
Threshold Bit Score: 106.692
Threshold Setting Gi: 971760518
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
pohc:D11S_2263 120 KRFTVELTEYELQQLVWLWFAFKRGVGTFQHIEKAFNALGSNMSGKIYGQAYEYLSVLRTTNQTLNRLTKDID 192 Aggregatibacter phag...
P44193         119 EKFTHEFTEFEIETLVWLLIGHHQMNTLLGQLEKPLDAIGSNLHPAVYSYWKEYGRQYKDALPTIKRLMAPFK 191 Haemophilus influenz...
YP_009213793   131 pKIPMELTKKEWLRFASMWYALYNSLEVLATLEKPLRAIGSPFGATAYTHATEYQTTLGVMKRILEPMLADFE 203 Mannheimia phage vB_...
pohc:D11S_2244 189 elFTREFTEHELQQLVWAWFALLRGTELCQNLLPALKQIGSHYAAPVHDIAYEYRSTIRQAHNVLSRITDQFE 261 Aggregatibacter phag...
jgi:Asuc_1227  203 RKEQVALTEAELQQLAWDWFALFKCVEFTGYILPALDSIQSKFAPQAHSIVSEYGSMLRRHQPLLQKLTAEFK 275 Actinobacillus succi...
Q7N2X1         197 KQYKQQFTDDELCSLCWLWRDAVEMISSISDVYPILRAAEHRLEGKYYSMSHEYPRNMNIVRRVLNSLrfgnl 269 Photorhabdus laumond...
P03037         200 EKKTNDLSAKEANSLVWLWDYANRSQALFRELYPAMRQIQSNYSGKCYDYGHEFSYIIGIARDVLINHTRDVD 272 Salmonella virus P22
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap