Conserved Protein Domain Family
P22_AR_N

?
pfam10547: P22_AR_N 
P22_AR N-terminal domain
This domain was identified by Iyer and colleagues.
Statistics
?
PSSM-Id: 402260
View PSSM: pfam10547
Aligned: 24 rows
Threshold Bit Score: 140.876
Threshold Setting Gi: 290572070
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Sterm_0847         6 KKIVFHEDEILTFqdQETGK--IYVAVTMICNSLGMSenqRDTQVKKIKN-DGTLKLGAKELT--VKIDGQVREQMFIEL 80  Sebalde...
jgi:HSM_0868           8 QTISFNNQALVTF--EQNGT--HYTAMKPICENIGLD---WASQYSRIKR-DDILNSTIVIITt-VAEDSKIREMLCLPI 78  Histoph...
WP_012697005           7 vQVEFAGAVLDGV--IVDGV--AYVALRPIAEGMGLS---WARQYRKLMS-DPVLRSVVAEKAt-TGADGKQYTMLCLPE 77  Laribac...
Q310W0                12 EEVAVCGEYILAAv-TEDGK--AYFSPRHVCDALGIS---WSRQRKKIME-DDVLSSVVAEMAt-TARDGKNYKTSMLPI 83  Desulfo...
BAF60658              13 QKVRFYDDELMAAvvEKDGKqeIYVAVKPICEKFGLS---WPRQFRKIKG-HSVFSEGIALMA--TPSEGGQQTALCLNL 86  Pelotom...
jgi:Sterm_0815         4 KEIVFHEDKILTI--KENGK--IYVSVKHICNGLGMTesqCKNQRDKVNN-DYTLKGGRIFAP--LETNGGIQQVLMLEL 76  Sebalde...
WP_025330532           6 TFVSFHGSSLATV--KVKNT--IYVCMKSVVQGIGLD---WSTQHRKLKGcYQKYGCGFLS----IPVKSGTKKILVIPL 74  Snodgra...
jgi:Snas_5403         19 vHIPFHGRVIHTAl-SADGE--PVVILKPTVEEIGLD---FSAQLEKLKT----RSWAVVTETliSGADGKIYPMVSVNL 88  Stackeb...
cebbi:ckrop_1633       7 ipVPGANAELKAVq-TEDGK--EWASPRHICEVLGLD---WKSQHRKLHD----KSWACVVKMt-MQVSGQGREMFMVDR 75  Coryneb...
goetting:NONO_c73240   8 iAVPGADRQIVAT--EIDGK--PMVSVRHACEAIGID---YSTQIARLKR----WSWATVGMSttVGSDGKAREMAMIDR 76  Nocardi...
jgi:Sterm_0847        81 EFLTGWLFKINPARFSEELKEKLIDYQLHCQEILTDEFF 119 Sebaldella termitidis ATCC 33386
jgi:HSM_0868          79 DYLNGWLFGIDVNRCKPEIRETLIKYKKECYAALHDYWF 117 Histophilus somni 2336
WP_012697005          78 TYLQGWLFKVNPDKVQPSIRDKVIRYQRECYEVLHQAFT 116 Laribacter hongkongensis
Q310W0                84 EFANGWLFTI--KKVRPELQDKLNLFRAEAYHAL-DLWF 119 Desulfovibrio alaskensis G20
BAF60658              87 DYLPAYLMTIHPTKVCSELRDKLVIYQKEAARVLRDYFV 125 Pelotomaculum thermopropionicum SI
jgi:Sterm_0815        77 DYLPIWLAKINPSRFNEELKQKLLDYQLHCKDILADEFF 115 Sebaldella termitidis ATCC 33386
WP_025330532          75 KKLTNWLQSINPKKVKDSLKELVGVYQNECSQAIHSHWR 113 Snodgrassella alvi
jgi:Snas_5403         89 ETWSMLLANVDENKVILAARPIVIAYQRESAKALRDYWT 127 Stackebrandtia nassauensis DSM 44728
cebbi:ckrop_1633      76 RTLTMWLATIDTNRVAPEARPTLEAFQNEAADALDRYFN 114 Corynebacterium kroppenstedtii DSM 44385
goetting:NONO_c73240  77 RTFTSWLTHIDANRVAEQARPIVEAFQAEAADALDAYFN 115 Nocardia nova SH22a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap