Conserved Protein Domain Family
ITAM_Cys-rich

?
pfam10538: ITAM_Cys-rich 
Immunoreceptor tyrosine-based activation motif
Signal transduction by T and B cell antigen receptors and certain receptors for Ig Fc regions involves a conserved sequence motif, termed an immunoreceptor tyrosine-based activation motif (ITAM). It is also found in the cytoplasmic domain of apoptosis receptor.
Statistics
?
PSSM-Id: 402252
View PSSM: pfam10538
Aligned: 9 rows
Threshold Bit Score: 66.2259
Threshold Setting Gi: 476002378
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AIF28793  595 ETKPHSGLYKRLCVFQYKNRCYIFTIWIFLLIFQMLVW 632  Imjin virus
P08668    607 PQNFTPGCYRTLNLFRYKSRCYIFTMWIFLLVLESILW 644  Hantaan virus 76-118
AGK36763  160 SKPKKQGCYRTLNLFRYRSRCYIFTVWIFLLTLESVFW 197  Asikkala orthohantavirus
P21400    617 VYEPMQGCYRTLSLFRYRSRFFVGLVWCVLLVHHLIVW 654  Puumala virus bank vole/CG1820/Russia/1984
O12371    610 KPEVHRGCYRTLGVFRYRSRCYVGLVWGCLLTIELVLW 647  Laguna Negra orthohantavirus
AND78464  608 TPTHGTLLYRKLGTFRYKNRCFIFTIWTVLIIIESLVW 645  Quezon virus
AJZ68871  604 VPNQTTMCYRRLGTFRYKNRCYILIVWLIMLTIEILCW 641  Laibin virus
AGI62348  609 QTPLYSRKVRKIQSFRYRNRCFILTVWIILLTVESLIW 646  Longquan virus
AKE37996  604 PLHPSSIIIRKVSNFRYKNRCYISMVWTLLLIIELCIW 641  Nova virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap