Conserved Protein Domain Family
Engrail_1_C_sig

?
pfam10525: Engrail_1_C_sig 
Engrailed homeobox C-terminal signature domain
Engrailed homeobox proteins are characterized by the presence of a conserved region of some 20 amino-acid residues located at the C-terminal of the 'homeobox' domain. This domain of approximately 20 residues forms a kind of a signature pattern for this subfamily of proteins.
Statistics
?
PSSM-Id: 402244
View PSSM: pfam10525
Aligned: 17 rows
Threshold Bit Score: 63.9292
Threshold Setting Gi: 1005964315
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013881580 230 ASGFKNGLALQLMAQGLYNHSTTTIQEDKED 260 Austrofundulus limnaeus
XP_010573522 112 ATGIKNGLALHLMAQGLYNHSTTTVQDKEES 142 bald eagle
P09015       234 ASGVKNGLAIHLMAQGLYNHSTTSKEDKSDS 264 zebrafish
P31533       230 ATGNKNTLAVHLMAQGLYNHATVTKDDKSDS 260 zebrafish
Q68EL7       201 SSGFKNALAMQLMAQGLYNHSTTTIQEEEDn 231 zebrafish
XP_003966514 248 ASGYKNSLALQLMAQGLYNHSTTTVQDEKDE 278 torafugu
XP_003968082 236 ATGNKNSLALHLMAQGLYNHSTVTSKDEKSD 266 torafugu
EKC23208     199 STGGNNTLALKLMSQGLYNHSTVTVSDEGES 229 Pacific oyster
XP_002414237  68 ASGQRNPLALQLMAQGLYNHTTASQQGMGDD 98  black-legged tick
XP_794753    193 ATGLKNGLARQLMAQGLYNHSTVPLDGDDMD 223 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap