Conserved Protein Domain Family
NfI_DNAbd_pre-N

?
pfam10524: NfI_DNAbd_pre-N 
Nuclear factor I protein pre-N-terminus
The Nuclear factor I (NFI) family of site-specific DNA-binding proteins (also known as CTF or CAAT box transcription factor) functions both in viral DNA replication and in the regulation of gene expression in higher organisms. The N-terminal 200 residues contains the DNA-binding and dimerization domain, but also has an 8-47 residue highly conserved region 5' of this, whose function is not known. Deletion of the N-terminal 200 amino acids removes the DNA-binding activity, dimerization-ability and the stimulation of adenovirus DNA replication.
Statistics
?
PSSM-Id: 371114
View PSSM: pfam10524
Aligned: 4 rows
Threshold Bit Score: 72.6493
Threshold Setting Gi: 167869400
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDO45394   7 FDQQDEIHSFIESLLPHVKAFAYTWFNLQARKRKHYKKHDI 47  starlet sea anemone
EDX15193  24 SSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEK 64  Drosophila simulans
EDS32783  13 SQQQEDFHPFIEALLPYVKSFSYTWFNLQAAKRRYLKKHEK 53  southern house mosquito
Q09631    50 sPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDK 90  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap