Conserved Protein Domain Family
SHNi-TPR

?
pfam10516: SHNi-TPR 
SHNi-TPR
SHNi-TPR family members contain a reiterated sequence motif that is an interrupted form of TPR repeat.
Statistics
?
PSSM-Id: 402238
View PSSM: pfam10516
Aligned: 22 rows
Threshold Bit Score: 50.1391
Threshold Setting Gi: 124479772
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9USQ4       199 ADIYDLLGELSLEIENFSQASQDLKTALEWKEKVYNVS 236 Schizosaccharomyces pombe 972h-
NP_956076    386 AQIHLKLAEVGVESGNYSQALEDFNECLTLQLKHLPSH 423 zebrafish
A0E096       164 AKVYIKLAELDQWRDKFDDAQENLQKSLQLRLQCENQE 201 Paramecium tetraurelia
Q17886       191 ADVLVLLGEHGISDGKYTQAFEDLDRALNIQRNVLPPS 228 Caenorhabditis elegans
O17687       379 ADVLTSLGEHGIADSKYEQAQKDLTEAISIQTVHLPAT 416 Caenorhabditis elegans
Q5KLE0       202 SDCYLALGNVSCETENFPQAVQDFTAAVDIQNTIMPPS 239 Cryptococcus neoformans
Q7PGM3        34 PECYTELAGISFENSFFKEAIKDYVKALEIYQKTKQPD 71  Anopheles gambiae str. PEST
Q7RNQ1       156 SYVFIRLGDISLLNHFFEEALKEYEKCVNLREEHKLGD 193 Plasmodium yoelii yoelii
EDO05798     153 SYCCVRLGDMFFTNNQFPEAATEYQRAVELRRQYHVPE 190 Babesia bovis
XP_011388944 203 AEVMNLLGDVGLESENFTQASADYRSSLNILLPLLNRH 240 Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap