Conserved Protein Domain Family
Proteasom_PSMB

?
pfam10508: Proteasom_PSMB 
Proteasome non-ATPase 26S subunit
The 26S proteasome, a eukaryotic ATP-dependent, dumb-bell shaped, protease complex with a molecular mass of approx 20kDa consists of a central 20S proteasome,functioning as a catalytic machine, and two large V-shaped terminal modules, having possible regulatory roles,composed of multiple subunits of 25- 110 kDa attached to the central portion in opposite orientations. It is responsible for degradation of abnormal intracellular proteins, including oxidatively damaged proteins, and may play a role as a component of a cellular anti-oxidative system. Expression of catalytic core subunits including PSMB5 and peptidase activities of the proteasome were elevated following incubation with 3-methylcholanthrene. The 20S proteasome comprises a cylindrical stack of four rings, two outer rings formed by seven alpha-subunits (alpha1-alpha7) and two inner rings of seven beta-subunits (beta1-beta7). Two outer rings of alpha subunits maintain structure, while the central beta rings contain the proteolytic active core subunits beta1 (PSMB6), beta2 (PSMB7), and beta5 (PSMB5). Expression of PSMB5 can be altered by chemical reactants, such as 3-methylcholanthrene.
Statistics
?
PSSM-Id: 371102
View PSSM: pfam10508
Aligned: 7 rows
Threshold Bit Score: 538.549
Threshold Setting Gi: 74964288
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDO34558       2 AAEKCKELVENISNAsgDEIVAFLRDLSVLISSSPnIRDLASLIPS-----ERLFNCLR--TT----NTDQITYCKNILK 70  starlet sea ane...
Q16401         1 MAAQALALLREVARL--EAPLEELRALHSVLQAVP-LNELRQQAAElr--lGPLFSLLN--EN----HREKTTLCVSILE 69  human
Q20058        11 IEEWRNDYIAERSSKkgWEILEKLAKMQIEAAQQMeTEDDVAAA---------DFDDFS--TS-------------KLVK 66  Caenorhabditis ...
XP_002642096  11 IEGWRNDYVSNRNSKkgWEILENLVKMQTEGNQQMeTDEMSENC--------AAFDDFS--TN-------------QLIK 67  Caenorhabditis ...
Q16R63         2 DENLCQELLANLQLE--QTRKTALTEIKNTLISSSnASAISNSFLKs----PELLNCLE--DA----NSEQTLLACDILS 69  yellow fever mo...
Q9VYG1         4 EDNWWVTKLKALESK--PQRLDALTAMNSAIAKEA---ALPRQIIErllttDQLYDCANpaADshvpKDQAVDVTLELLC 78  fruit fly
XP_003965288   1 MAATIEGLLGEISGV--EHPTEELQLLKTALLSIP-VNALRDAVSGqr--fNVIFALLN--SD----CREQVELCVDILE 69  torafugu
EDO34558      71 NILKFEKPDAPATKYHDAVIEGLNHPTEDVRELCLIE----LERCSGTVNGVLALMDKEDLLSYIARGMADEHLKNAQIA 146 starlet sea ane...
Q16401        70 RLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQ----IGRIVENSDAVTEILNNAELLKQIVYCIGGENLSVAKAA 145 human
Q20058        67 LIIGDISTKDLLVDHQIILLEFIPSAHPNILRH--------VVRTVREKEGAISLLKSSSVAIGVAFARRVTDAEAGEEV 138 Caenorhabditis ...
XP_002642096  68 LIIGDFTVKDLLVDHQVVLLEFIPSAHPNILRH--------VARIIREKEGALPFLKTESIAVGIAFARRITDSDAGEEI 139 Caenorhabditis ...
Q16R63        70 ICMSTLAIDE-SSEVKNVIEKSLSHVNPRVQAFGLRE----LRRIVQSRSA--DGFVNETLILLVIKCLASDDTSVGTPA 142 yellow fever mo...
Q9VYG1        79 HCLDQLAMDTADEQLSSLLRRGLTHSNPALRAQVLASlfkkLLR--QLTVGQVLTLPNNELIFLILDELKQPDTQSTSLA 156 fruit fly
XP_003965288  70 RILIALSPVCLVQKYRAELQAGLTHPNDTVKILALTQ----IGRILEHPDAATEVLNNHDVLQAVIQCIREEKIAVAKQA 145 torafugu
EDO34558     147 SNVFTNLAKHEAGLKVLfdshlQSEFNALLKT-KDTVRMRVYDMYITVQAHSPKAFDVCKEsgIFEKLISELDG-RDVLV 224 starlet sea ane...
Q16401       146 IKSLSRISLTQAGLEALfesnlLDDLKSVMKT-NDIVRYRVYELIIEISSVSPESLNYCTTsgLVTQLLRELTG-EDVLV 223 human
Q20058       139 GRLMAHLVDHDLINEEL-----KSQLSVANGReSSSIRSRIYSIATERARISSNTSCIHW---LYDKILKSVLDtQDVLA 210 Caenorhabditis ...
XP_002642096 140 GRLLAHLVDNEKICDEL-----KFILKNNTGRnNAMNRASIFSIATERAGISADASCIRW---LYEEILKVVLDkEDMLA 211 Caenorhabditis ...
Q16R63       143 IELLRLMLPRFVQLRSV-----SENLEGLLDK-GDVVRCRLYELAVRLAKQSEELLAAMDK--FLKKAVQELDG-EDVLL 213 yellow fever mo...
Q9VYG1       157 INILSIVLPQRISNADV-----QAKLVQLLKQ-NEIVRCRAYELAVVLAKKSATLLSDVTF--ILDAALSELDN-DDVLL 227 fruit fly
XP_003965288 146 IQCLSKLSHSKPGLDKLfhgdlLAVLKDVMAT-SDIVRYRIYELVVEISSVSPISLGYCANssFISQLLGELTG-DDVLV 223 torafugu
EDO34558     225 QMNCLELLTKLASiSPSGLEYLDQKGVVTKLNNLLLEVETDP-LITLIIPGIIKFFGTLATA-HPLETTQQYPQFLEQTY 302 starlet sea ane...
Q16401       224 RATCIEMVTSLAY-THHGRQYLAQEGVIDQISNIIVGADSDP-FSSFYLPGFVKFFGNLAVMdSPQQICERYPIFVEKVF 301 human
Q20058       211 QLDALDTFVDIALsGKQNAEALYELGIVKKIYELMEWSKESPdGGEMYLYGT-RFMCYMAR--SYPQVLKYFPDLARRLM 287 Caenorhabditis ...
XP_002642096 212 QLDAINIFGDIALsGKQNAEKMIEWNIVEKISELMERSRQNPdHGEMHLYGT-RFFCYLAR--SCPQVLKTFPDFVNRLM 288 Caenorhabditis ...
Q16R63       214 QLNVLQILSELSE-GNHGMAYLENNGVFDKLMVKIQGLGEDP-LGTILIPGLMKFYGGVAAI-HPAKVYDGYPKVIEMLF 290 yellow fever mo...
Q9VYG1       228 QASVMELLVPLAE-QNHGLSYMERRRVLDIISYRVQRVEEHP-LDALLVPSIMKFFGKISVY-QPLKIIGGYPHMLACLF 304 fruit fly
XP_003965288 224 RATAIEMVTTLAQ-SQHGRQYLAQQGIMDKISNMIRGAETDS-FSSLYIPGLVKFFGNLAIMdSPQQVCETYPAFQNKVF 301 torafugu
EDO34558     303 ---SMISCGDPTLMPIAMETIGVIAHSEDGLRAV---FNNQGRNKHIMKTIFGHATSSQVDLRKRALEALASIFYSEQLT 376 starlet sea ane...
Q16401       302 ---EMIESQDPTMIGVAVDTVGILGSNVEGKQVL---QKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQ 375 human
Q20058       288 leiRMFDQLSVVSRLGAFDHFASMCFSVEAKETLedmFKDSKDLENTLGAAGAACTMGTMELKCRTLQAVTLLFQNTTE- 366 Caenorhabditis ...
XP_002642096 289 feiRIFNDLGITDRLAAFDHFGCLCYSVEAKEMLedmFKNTNTLDSTLAAAGAAFAMGSIEMKRCTIQAITLIFENATD- 367 Caenorhabditis ...
Q16R63       291 ---DCLASEDMTILPTAYDTLGCIAAANEGKRQLh--YKHGAALKKTLQHFSKVIRNLPNDLKIRLLGCLRSM--FAVDS 363 yellow fever mo...
Q9VYG1       305 ---MQLQSEDESILPTAMDTLANLATTPQGKILLn--MHFSGAMEKSFKKYGSHTKKLSAHIKKRLLNSLDVIYDFKTPP 379 fruit fly
XP_003965288 302 ---EMALDPDPVMNGVALDTLGLLGSTIEGKQVL---QKTGEQFRTVLRRMSQLASSGATELRVRSLDAISQLLTLQPEQ 375 torafugu
EDO34558     377 PSEELCEFAKVLYKNMAAAPLE-AIFTVAKQPFEELRCSALCLLRSLARYQWALQDMINCPGFLEYLLDRRTEFEKSGKE 455 starlet sea ane...
Q16401       376 QTDDLLRMTESWFSSLSRDPLE-LFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKD 454 human
Q20058       367 ------KIAETWYERLGGKALThVAVGNVKKPFPEMKNCIYDFWQQLFTYPSVVHQFITFQGFIDWALDDKSEDNPEYEI 440 Caenorhabditis ...
XP_002642096 368 ------AMASSWYGLMGDKALTqVALDNVKKPFPELKNCIYDFWQQVFKYPTLVQKFIAFPGFINWSLDEKSENAPEYEM 441 Caenorhabditis ...
Q16R63       364 ADNQISSITQEWYGNLAEQENLnLVMDYIKNPFPDMKRAALGLLKAIVGHRWGQTYLLNTGGFVEYLLDRKQEADKDVVL 443 yellow fever mo...
Q9VYG1       380 ATEII-NIGKNWYECFAGGAHAnIIMDLINTPFPDLQMAALSFLKTICKYNWGIVALKNTGGAVEFLLSRQKDLHRDIKY 458 fruit fly
XP_003965288 376 QTEDLLALTESWFHLLSKQPMD-MIRNISTQPFPELHCGALRIFTAIATQPWGQRLMVSTPSFMEFVLDRSTGQTKEAKD 454 torafugu
EDO34558     456 HKYDLIKELVHFPP----AKQIFDRPYFL-RLQEYEREGPFFARAEAAVAFE--GAD 505 starlet sea anemone
Q16401       455 AKYELVKALANSKT----IAEIFGNPNYL-RLRTYLSEGPYYVKPVSTTAVE--GAE 504 human
Q20058       441 RKRQIIHRIIELSEntksAEVLKADPELIgRLKKYLQ---------PAVAPAprVEE 488 Caenorhabditis elegans
XP_002642096 442 RKRQVIRRVIDLSEk--eSNILNADAELIgRLKKYLQ---------PSAAPAprIEE 487 Caenorhabditis briggsae
Q16R63       444 DKYEVIRVLA--------ASTVFDEQTAS-ELRRYVAEGAFYVQGITEVAIE--GAS 489 yellow fever mosquito
Q9VYG1       459 MKWQIMEILS--------ASAEFSPTETI-RFTAYVNEGPYHVQADLDVATEpqGNA 506 fruit fly
XP_003965288 455 AKFELVGSLVSSST----AVQILGSQQYI-SLKAYLREGPYYVSAVASVATE--GAE 504 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap