Conserved Protein Domain Family
TMEM65

?
pfam10507: TMEM65 
Transmembrane protein 65
MEM65 is an intercalated disc protein that interacts with with connexin 43 (Cx43) and is required for correct localization of Cx43 to the intercalated disc. It is essential for cardiac function in zebrafish.
Statistics
?
PSSM-Id: 402231
View PSSM: pfam10507
Aligned: 46 rows
Threshold Bit Score: 105.268
Threshold Setting Gi: 209583388
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EED90065          28 HQSIPFVGFGIMDNSILLLAGEAIDTTLGVTLGISTMCAAAIGNIISDVVGVAFGTVIEDAIARwsgrierlsngkVKLp 107 Thalassiosi...
jgi:MICPUN_74385   2 FNAVPFVAFGFIDNTVLIYAGDAIDNSVGVAFGLSSLAAAAMGQIFSDTSGVLFGGAIEAWVLR------------AGF- 68  Micromonas ...
XP_003058461       2 FSAVPFVAFGFVDNTVLIHAGDAIDSTFGVALGLSSLAAAALGQIFSDTSGVLFGSTIEGFVLR------------CGL- 68  Micromonas ...
CAM65792         668 AAAPPFLAFGMLDNSTLVLAGGAIDNALSGSLGLSQMAAASLGGVVSGVAGIQVHGLAERYTRA---------------- 731 Leishmania ...
Q57ZW2           303 SASVPFMAFGILDNSIFVTAGDAIDRRCAEAFGLTSMTAAALGGVVSGVAGVQMHGVAERFTQR------------VRLa 370 Trypanosoma...
Q4CY30           292 SSAVPFMAFGMLDNTIFITAGDAIDKRFAEAFGMSTMAAAALGGVVSGTAGIQMHGLAERMAQR------------SRLa 359 Trypanosoma...
Q38AF3           146 VAGLPFVGFGFLDNAMMILAGDAIDNSFGLYFNCSVLTCAAMGNIFSGVLGMQLHGVIEKAVQR------------FNF- 212 Trypanosoma...
CAM44473         165 EAALPFVGFGFLDNSTMILAGDMIDGSLGFYLNCSVLASAAMGNVCSGVLGMQVHGLIDNTVQK------------LNL- 231 Leishmania ...
Q84X76           163 AAAIPFVAFGFLDNAIMLVAGEEIDHMFGLRLGLSTLASAGLGNAVADVIGVGAAKYIEQAVRW------------LPFv 230 Chlamydomon...
PIC39896         102 inFIPMFVYGCLDEALIIIGGESINNIFSVYNGMSMLASAAVANIIVN---LFLQLPADRWTDI------------LGF- 165 Caenorhabdi...
EED90065         108 PLPKLSHEQRNLRSVRLASQLGCAIGLTVGCIIGMFPLLFF 148 Thalassiosira pseudonana CCMP1335
jgi:MICPUN_74385  69 AQPVLTAEQNMMRVTRMTSTAGKVCGVVTGCCLGLLNLLLI 109 Micromonas commoda
XP_003058461      69 AAPSLTPTQQLARGVRVASTLGKVFGVVLGCSLGLVNLL-- 107 Micromonas pusilla CCMP1545
CAM65792         732 APPRLTMEQQRSDAYSRATQAGNTLGMVFGLILGMIPLLFM 772 Leishmania infantum JPCM5
Q57ZW2           371 RVPVLTAAQQKSKARGSATRVGNTAGMLVGLLLGMIPLLFV 411 Trypanosoma brucei
Q4CY30           360 RPPTLTPSQSASASNGSATRVGSTLGMILGLLFGMTPLLLL 400 Trypanosoma cruzi
Q38AF3           213 RVPTLTENQMKGKRVFFAGHIGGTVGIMTGLLLGMIPLLLL 253 Trypanosoma brucei
CAM44473         232 NTPVLSEEQLKDRRVFLAGHLGGTLGIMLGLILGMLPLLFL 272 Leishmania braziliensis MHOM/BR/75/M2904
Q84X76           231 KEPKLNKYQNAMPATQRAKLAGAMLGVFCGCMLGLTPLFLs 271 Chlamydomonas reinhardtii
PIC39896         166 KKPVLSNDQMNTPEYHYASFAAKLSGLWLGLTLGMLPLFFI 206 Caenorhabditis nigoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap