Conserved Protein Domain Family
DUF2452

?
pfam10504: DUF2452 
Protein of unknown function (DUF2452)
This protein is found in eukaryotes but its function is unknown.
Statistics
?
PSSM-Id: 371098
View PSSM: pfam10504
Aligned: 22 rows
Threshold Bit Score: 227.558
Threshold Setting Gi: 341882705
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Hhal_0051   7 DDNPDRheghSRTSPYPVSRLSAPIDLVDTAREIQEADQAINNRTSSKLTVIADQIRALQEQAREVLEESQRDMDLHRAK 86  Halorhodospira...
XP_001603144   29 ERNVVPqg-lQLVNPKAVARK-APIDLVDLAKEIQKADSFVKANACSKLQMIAEQMRFLQQQAERVLLEAKENTSLHHAA 106 jewel wasp
XP_397054      15 ERNIKPqg-iLLNDPESVAKT-CQQDLITLATEIEKADNFIKANTCSKLQIIVEQIKALKKQAENILTEADWNMKLHHVS 92  honey bee
EFN76746       25 ERNIMPqg-iLLVDPTAVAKS-NQQDLMALVAEIQKADSCIKANACNKLQVIAEQIKFLQKQAEGILLEAERNAKLHHVA 102 Jerdon's jumpi...
XP_004997329   26 DSNPEVt--kQMVSTSAVHRMNDPNDLVTLAQYVQTADDFTKATVGGKLELIADQIKALQDQARQVLESAKRDVELNHAK 103 Salpingoeca ro...
WP_005224802    4 dhkPVPytgdERSAPYPVSRLAPAFDTRELTAEVERAEAMLGARTGAKLRVIADQIKLLQQEARKVLADAQVEQALNQAQ 83  Marichromatium...
XP_002051545   24 ERNPQFq-----LDPMRVSMH-DETDIINLAQQIQTADKQLKHSTSQKLVVILDQIKMLQAQAMNILKESNESRTLHSAA 97  Drosophila vir...
Q8INX1         17 ERNPQLq-----INPMRVSMH-QEEDIIELAQQIQNADKQLKNTTCQKLGVIMEQIKMLQAQAMEILKESTLNRDLHSAA 90  fruit fly
Q17AF5         24 ERNPCPng-tQIVSLYRSGRR-EAEDIVELAKEIQSAEIQVKNNACAKLLVIAEQVKFLQEQARKILEETQSAQDLHQAA 101 yellow fever m...
Q7PWU0         16 ERNPAPng-tAIVSMYRTGVR-EANDIVSLAKEIQSADVAVTNNACAKLVMIAEQIRFLQQQAKKILDETQSAQQLHHAA 93  Anopheles gamb...
jgi:Hhal_0051  87 CNFTRRPGSIYHLYERDD-GELYFSMLAPEDWRN-GPPHTYKGSYRLEADLSWTPFEEMDQPDATRDMVQRLIAD 159 Halorhodospira halo...
XP_001603144  107 CNFVKHPGKIYHLYQRES-GQMYFSMLSPEEWGEsAPQQMYKGSFRLEHDHSWTPLSKVNIRDEELAILNKLYQs 180 jewel wasp
XP_397054      93 CNFVKHPGHVYHLYQRET-GQLYFSMISPEEWGNsGPIQIYKGSYRLEHDRSWTSLEEIDKKNKEITMLANLWsn 166 honey bee
EFN76746      103 CNFIKQPGHVYHLYQRES-GQLYFSMISPEEWGNsAPSQSYKGSFRLEHDHSWTPLSQLQRKDDELDIFNKFLPN 176 Jerdon's jumping ant
XP_004997329  104 CNFRRIPGKVYHLFRKESdGSTYFSMLSPEEWGD-RATDTFIDSYRLEYDMSWTPLSKIQERDERRRLDAQLLgv 177 Salpingoeca rosetta
WP_005224802   84 CAFKRIPGKTYHLYRRAD-GRTFFSMLSPEDWGG-AVPHAFVGSYRLETDYSWTPAEQIGAADDTGEMVSQLLri 156 Marichromatium purp...
XP_002051545   98 CNFAKKPGHIYHLYQRAT-GQTYFSMLSPEEWNH-SVDQTYKGSYRLEYDLSWTPIDKIKERDDKLKWVEKCINS 170 Drosophila virilis
Q8INX1         91 CNFTKKPGHIYHLYQRPS-GQNYFSMLSPEEWSL-SVDQTFKGSYRLEYDLSWTPLDKIKEQDEKLKWAEQCMLK 163 fruit fly
Q17AF5        102 CNFKKIPGHIYHLYKRDS-GQTYFSMLSPEEWGTgGCGHAYQGSYRLEHDQTWTAVEKLQEVSNNLKWARSLVDA 175 yellow fever mosquito
Q7PWU0         94 CNFRKIPGHIYHLYKRPS-GQTYFSMLSPNEWGPkGCEHQYLGSYKLEHDQTWTPVDKIEQVQENIRWAHRVLDT 167 Anopheles gambiae s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap