Conserved Protein Domain Family
Rod_C

?
pfam10493: Rod_C 
Rough deal protein C-terminal region
Rod, the Rough deal protein, displays a dynamic intracellular staining pattern, localising first to kinetochores in pro-metaphase, but moving to kinetochore microtubules at metaphase. Early in anaphase the protein is once again restricted to the kinetochores, where it persists until the end of telophase. This behaviour is in all respects similar to that described for ZW10, and indeed the two proteins function together, localization of each depending upon the other. These two proteins are found at the kinetochore in complex with a third, Zwilch, in both flies and humans. The C-terminus is the most conserved part of the protein. During pro-metaphase, the ZW10-Rod complex, dynein/dynactin, and Mad2 all accumulate on unattached kinetochores; microtubule capture leads to Mad2 depletion as it is carried off by dynein/dynactin; ZW10-Rod complex accumulation continues, replenishing kinetochore dynein. The continuing recruitment of the ZW10-Rod complex during metaphase may serve to maintain adequate dynein/dynactin complex on kinetochores for assisting chromatid movement during anaphase. The ZW10-Rod complex acts as a bridge whose association with Zwint-1 links Mad1 and Mad2, components that are directly responsible for generating the diffusible 'wait anaphase' signal, to a structural, inner kinetochore complex containing Mis12 and KNL-1AF15q14, the last of which has been proved to be essential for kinetochore assembly in C. elegans. Removal of ZW10 or Rod inactivates the mitotic checkpoint.
Statistics
?
PSSM-Id: 402219
View PSSM: pfam10493
Aligned: 17 rows
Threshold Bit Score: 696.813
Threshold Setting Gi: 568254179
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007489958        1580 TMTMSSAAQIRLPFHLIFfgKVQNFWKILSAELREESFPTFLLIAKLMKVSLDS-LYVSTVK-QVFEKSLKPKLLKQVQA 1657 gray s...
WGS:AANI:GJ23087-PA 1543 G-VLPKIARYRLPFKPIV---EKPLKDILDSELNVDNCQSWFPLIL-MCTSLKN-SKDISQNcDYFCMAAVKNSIAEYKS 1616 Drosop...
WGS:AAQB:GK11720-PA 1537 S-VLPKIAQYRLPFKPIV---EKPLKDILDYDINVDNCQSWFPLIQ-MCTALKG-SKDSPQNcDYFCMSAVKNSMDELKC 1610 Drosop...
Q9V9W7              1542 G-VMPKISRYRLPFKPIV---EQPLKDILDSELNVDNCQSWFPLIQ-MYTALKG-SKDSSQNcDYFCMSAVKNSISEYKS 1615 fruit fly
Q16YZ4              1484 GGMLPKIAKYRLPFLLLI---RHPLKSLLKEEITIENYKKILLLVQ-MKAPLEN-MDPVELQ-DYFCKSAVINSISEYKI 1557 yellow...
ETN63171             986 GDMLPEIAKYRYPFMLIV---RQPLKQLLKEEIAIDNYQKLLVLVE-MKCALEG-FDCNEMN-DNFCKSAVVNSINEYKI 1059 Anophe...
XP_014324173        1571 GLMPNPLSSSRLPFHLLM--QTKHFWKIIsPELSEETFPTLLLISKLMKVSLDK-LYMSAAN-HVFEKKMKPLILEQRKK 1646 southe...
XP_015221522        1550 slprSPLTHTRLPFHLIFfkTSLYFWKIISAELSEETFPTLLLISKLMKVCLDK-LYMSAVN-HVFDKRLKPQSLKPSNG 1627 spotte...
XP_014339601        1560 AICLSSASQQRLPFHLLFfnTTQCFWNIISAEITDESFPTLLLISKLMKTGISThMLLILGAdk---------------- 1623 coelac...
XP_012824467        1593 GIAMPPTAQTRLPFHLLFftTASSFWGIISAELSEESFPTLLLISKLMKVSLDT-LYMMASK-HVFEKNLRPKALKLKNA 1670 tropic...
XP_007489958        1658 KGSTPN--------NKEIAKTFQTLQSYLLSIANPEWAVAVAINLAQDIPEGCYKItiLKFCLYLAEKWLKNISS----- 1724 gray s...
WGS:AANI:GJ23087-PA 1617 KNDSESws-----lHPTNNAFLKSILRLVKNVHSPSKVFLILYFVAGYAPEGADQVeaSYECWKYAKDH-GSLTN----- 1685 Drosop...
WGS:AAQB:GK11720-PA 1611 KSNSDAws-----lRPTNNAFLQAVLRLAKNMNSHNKAFLMLYYVSNYVRSGADQVeaAYECWKFAKKH-ALQLN----- 1679 Drosop...
Q9V9W7              1616 KNDSESws-----lHPTNNAFLQSILRLVEKVNNPNKAFLILYFVSNYARDGADQVeaSYECWKFVKEK-GHLIT----- 1684 fruit fly
Q16YZ4              1558 QADELAptag-whlQPVNNAFLQSILRVVDCVSDLSSKLFILYYVTNNAPEGADQVeaAYECYKFACQHEDALSG----- 1631 yellow...
ETN63171            1060 QNKEMAlahndwhrQAKNKAFLQSILRIVDSIKDLSSRLFILYYITCNASDGDDQVnaAYACYTFARKHETELAS----- 1134 Anophe...
XP_014324173        1647 AQGHGY--------NKETLKVAKTMMKYIQCIQSLEWAAATAHKITQELP------------------------Pglekt 1694 southe...
XP_015221522        1628 RKPHVM--------TKETIKTMETIKTYLLSIKNPEWAAAAAHKIAQELPTGILKTtsLNFCLLLAEKWLKTSSP----- 1694 spotte...
XP_014339601        1624 ------------------------vGTSALEFRKFHCLFSL--------VAGPEKNyaLKFCMHLTQKWQDSLTP----- 1666 coelac...
XP_012824467        1671 EHFSII--------NKDTAKTVLTIQSYLQSISNPEWAAAIAHKIAQELPTGPDKIhaLKFCLHLAEKWKKNILP----- 1737 tropic...
XP_007489958        1725 -------------------QDETHEKAEALLKKLRVQYQRSGTETVLITHGLGSPEHLRLLGKPAQLIASLYEHGSILPR 1785 gray s...
WGS:AANI:GJ23087-PA 1686 -------------------DPKCQDQ----LAKIKRRYPIQKTQHLLYVYGMTDEKLLRLVEHPIELIHSLYHHELILKS 1742 Drosop...
WGS:AAQB:GK11720-PA 1680 -------------------DPMVKEK----VIKIRSKYPKQKTMLLLHTYGLTDEKLLQLVSDPRELISSLYHNDLIIKS 1736 Drosop...
Q9V9W7              1685 -------------------DPKSREQ----VAKVKRRYPIQKTQHLLYVYGLTDEKLLRQVENPTELIQALYHHELILKS 1741 fruit fly
Q16YZ4              1632 -------------------NSDAKDK----MEKIIRKYPIFKTQHLLLQYGINDDKLFALIKNPRELINALYSETVQRKV 1688 yellow...
ETN63171            1135 -------------------MPEAKEK----LEKIFRKYPLLKTQQLLQQNGVTEEKQFQLVRNPHELIMALYSDSCFQQV 1191 Anophe...
XP_014324173        1695 qslryclglgeawlkdpnlEEAARARGETFLSKLKLQFQRSATENMLISSQLSSPELLKLSGLPARLIMALHEHSSVEQR 1774 southe...
XP_015221522        1695 -------------------EDPAHAKAEIFLEKLKLQYQRSATENTLISYHLNSPEYLKSTGFPAKLIVSLYEHSSIEQR 1755 spotte...
XP_014339601        1667 -------------------QDEAREKAGFLLNKLTVLYQRSATENVLIAHSLNSAQYLKLTDMPSKLIESLFGHDSIEQR 1727 coelac...
XP_012824467        1738 -------------------KDDAHEKADVFIKKLSVQYQRSATENVLITHKLNTPEFLKQIGKPANLIVSLYEHSSVEQR 1798 tropic...
XP_007489958        1786 IQGPADKDCPDIHAAAKEIAEINNLDLEKIWDVLLEKWLCPATQT-----NEIPSEF----F-NLQ-------------- 1841 gray s...
WGS:AANI:GJ23087-PA 1743 SKV-------DINALVKEICALHELTLSNIQFKLLQNWLSVTMETt---dGTILEET----FlEDQnwpehgsn--ghgd 1806 Drosop...
WGS:AAQB:GK11720-PA 1737 GTI-------DINALVKEIADLHELDLDAIQFSLLQKWLSVTMEQt---dVTVHEET----LvEDPfgtpndgidavngl 1802 Drosop...
Q9V9W7              1742 SKV-------DINALVAEIAKLHDLCLATIQYRLLQKWLALTMESag--dGTILEET----FmEEQnwpeqang--aess 1806 fruit fly
Q16YZ4              1689 ----------DINSLVCEIAKLHQLDIDAIQVSLIQKWLSIFGSSnd--sDGNMEET----LyEDHnmsida------sd 1746 yellow...
ETN63171            1192 ----------KVNELVSVIGELYELDIEGIQMQLLQKWLTIFGGTtsensASMLEET----LyDDHnmsdas------qe 1251 Anophe...
XP_014324173        1775 YRETGGQTFPdIHAAVREIATINNVDLGKIRNMLLEKWICKTGPAvtkevgnqdcv------------------------ 1830 southe...
XP_015221522        1756 LKNPAGRNYPDIHAVAREIASINNIDLSKIRDLLLDKWLCQSTAP-----AVKDNNTqhyvT-DIQ-------------- 1815 spotte...
XP_014339601        1728 VRNPIGRDYPDIHAAANEVAEINNLHMNKIRDVLLEKWLCPSTQPvv--dGKKTQDF----FsNIQ-------------- 1787 coelac...
XP_012824467        1799 IRYPTGRDYPDIHMAVKQISEVNNLNMSRICTLLLEKWICPPALPq----ADKSKDV----FgDIH-------------- 1856 tropic...
XP_007489958        1842 ----GDEALQRVLYLLQIRPIDYSSRMLFLVATSSVSPFTVG-----QLTFAYRRRALHCLLCLADRETIESLFKKPYEE 1912 gray s...
WGS:AANI:GJ23087-PA 1807 dtgnASENVVRAFYLLSSWPKSEAVQFLVGLIFKGGP-----------VNTSTQLQMYECYSKLNDGSN---SFSNTINQ 1872 Drosop...
WGS:AAQB:GK11720-PA 1803 tvniTSENVIRAVYVLSSWPKSDAVKFLIGFIFKGGS-----------VNTSTQLQMYECFLKLNDGSN---IFADIITQ 1868 Drosop...
Q9V9W7              1807 nsqdASENVNRAFYILSSWPKAEAVKFLVGLIFKGGS-----------VNTSTQLQMYECYSKLNDGSN---SFTNTISQ 1872 fruit fly
Q16YZ4              1747 vdisADEYVARAHYILKSWDKEKSVSFLITQLCTGDSG----------VDAKKQLQIYDCFSKLIDDRCS--VYVDAFNP 1814 yellow...
ETN63171            1252 deegVHEYMKRAYYILSSWERSKSVEFLVAQLNTSTDGVS--------SDVGKQLHIYQCFSKLVDEECN--PYQTFFTQ 1321 Anophe...
XP_014324173        1831 tnieedpdllrTVYMLQSYPVDVATRLLSPILCAETW---PLsssgpRLTFCHRTRALLCLIRLADAESLEAQLQIPRSK 1907 southe...
XP_015221522        1816 ----EDPELMRVIYLLQMYPMDFSARMLYAIVTAEVSPISNSg---pRLTFGNRSRALMCLIQIADTKTLESLLKTSIEK 1888 spotte...
XP_014339601        1788 ----EDPELIRVLYLLQPYPLDYSTRILFAIATSATSPISVV-----QLTFAHRSRALQCLIHIAGTEAVVALFKKPIEK 1858 coelac...
XP_012824467        1857 ----GDEDLRRVIYLLQPYPVDYSSRMLYAIATSATSPIGDN-----QLTYAHRSRALQCLIHLADTDTVVSLIKKPIDE 1927 tropic...
XP_007489958        1913 VKCF-LKCITFLAAFEMLNIPLTYESFHNS--PKEGMIKGLWKNHSHEPMAVRLVTELSLEYKVYDTQLWSGLLQKLLGF 1989 gray s...
WGS:AANI:GJ23087-PA 1873 REFItIKCVHKLKALGYNS---NIEKFADDncDKINILKMVWQRNAQNPLSLEVMADICLGFDIHLPKIWNGILKRMVIF 1949 Drosop...
WGS:AAQB:GK11720-PA 1869 KQFItIKCVDDLKALGYNC---NIDKFKDDqcNKIDILKMIWQRNAQNPLSLVVMANICLGFDIHLPKIWNGILKRMVIF 1945 Drosop...
Q9V9W7              1873 RQFIsIKCVHELKALGYKS---NLEKFSDDhcNKIDILKMIWQRNAQNPLSLEVMANICLGFDIHLPQIWNGILKRMVMF 1949 fruit fly
Q16YZ4              1815 NQYIvLKCIYFLKSLGFSNL--TVSKFEET--EKMTLLKRLWQSHATSSKGLEVIAYICLGYELFVPQIWNGVLKQMART 1890 yellow...
ETN63171            1322 QRYVaLKCVHLLKSLGLGNL--SIAKFEET--DKMALLKMLWQSHASNPKGLEVIALICIGYNIYLPQIWNGILKQMARL 1397 Anophe...
XP_014324173        1908 FkCY-LKSYIFVSQLEALNIPYTIQSFLSS--PKDGLVKGLWKNHSHEPQavrlvadlcleyqvydpqlwnsllqkllgf 1984 southe...
XP_015221522        1889 IKHY-LKYCIYLSEFEVLNIPYTVESFHSS--PKEGMIKGLWKNHSHEPRAVRLVAELSLEYQVYDPQLWNGVLQKLISF 1965 spotte...
XP_014339601        1859 VKYY-LKCCIYLAEFEILNIPYTFESFHSG--PKEGMIKGLWKNHSHEPRAVRLVVELSLEYQVFDPQLWNGVLQKLLGF 1935 coelac...
XP_012824467        1928 VKYY-LKCCIYLSEFEFLNIPYTLESFHSS--PKEGMIKGLWKNHSHEPRAVKLVTELSLEYKVYDPQLWGGLLQKILGF 2004 tropic...
XP_007489958        1990 NMISYLRNVLTAISNIHSLWQIPYFGRAWQRVSQIPLISASCPLNPTQLLACRESLVVLLECPVSMDLDMIGVAKQFSQL 2069 gray s...
WGS:AANI:GJ23087-PA 1950 NMVRELNALVDVLSCKPQLLHLDGLALAWDCVLTHPLKNAVQTRSIALEERLQKTLLRLQGCPVVDALNLYQFAELCMLI 2029 Drosop...
WGS:AAQB:GK11720-PA 1946 HMIQELNALLDELSCKAQLLHLDGLAVAWDYVLCHPLKNASHTHSFEQDEQLHKVLLRLQGCPVVHALNLQQFAQHCKLI 2025 Drosop...
Q9V9W7              1950 HMVRELNALLDVLSCRPHLLHLDGLAQAWDYVLCHPLQNAVELRSFKQEEVLHKTLLRLQGCPVVHALNLLQFAQLCIVV 2029 fruit fly
Q16YZ4              1891 NMISHLTMLLDIISAREQLTNLEGFRMAWEAIIKAPFRNANRVRSFDEDSTLAKSLILLQKCPISSSLNLLDIAEVCINA 1970 yellow...
ETN63171            1398 GMVANLRALIDIVTAKRQLFGLEGYRMAWELLIEQPFRSASREQSLAEDALLARSLVMVQRCPISFRLNLLEIARECVTV 1477 Anophe...
XP_014324173        1985 nlISHLQMVLEAIVAVPTLWEissfsrtwrsmilapfvsaSVPLSPDQQAMLYRTFVLLLkCPFLLNLDLIGIANRFAQF 2064 southe...
XP_015221522        1966 SMTCYLRKVLVALTAVHSLWQVPNFIRAWKSVILAPFLSASIPLSPQQLEMFYQTFVLLLKCPVLFDLDLIGIAKQFAQF 2045 spotte...
XP_014339601        1936 NMISYLRKVLVAITGVQSLWPIPVFSRAWRSAILAPFLSASCPPSPKQLEACYESFVLLIKCPVLGDLDLVGIAKQYVQL 2015 coelac...
XP_012824467        2005 NLMHYLRKVLVAISGVHCLWEIPNFSRAWRSAILSPFITASCPPSPSQMEECYECFVVLLKCPVLADLDVVGIAKQYAQI 2084 tropic...
XP_007489958        2070 ELPAFALACLLLMPHSDKRDQQLQNFLGWCNPEVILQQIDEHMNTGQLAGFACQVKG 2126 gray short-tailed opossum
WGS:AANI:GJ23087-PA 2030 HRPHMA-ATVLIYCQSTEQREKIKKLITSRHVDNLRQQILEL----EDAGLIPMVLN 2081 Drosophila virilis
WGS:AAQB:GK11720-PA 2026 QRPHMA-AALLAFCQSSQQREDIKKLILSRPMDNLREQILDL----EDAGILPVILD 2077 Drosophila willistoni
Q9V9W7              2030 HRPHMA-ASLLSFCQSSEQRQKIKKMIHSHPVENLRQQILDL----EDAGILPVVLN 2081 fruit fly
Q16YZ4              1971 NRVNMA--AILIPYANDDQKEPLKKLVANNMESTLRQQILEL----EEYGVASVITK 2021 yellow fever mosquito
ETN63171            1478 NRVNMA--AVLIGFADSEQKETLKKLIANNAVPNLKDQIQEL----EEFGLVTTITK 1528 Anopheles darlingi
XP_014324173        2065 NLHAFALGTLLLLPCANKKAQQIQGFLSMCNPVAVLEQVDEFMNTGELAGIPSQIRE 2121 southern platyfish
XP_015221522        2046 DLPAFTLGSLLLIPCSEKKEQQVQGFLSSSNLVTVLQQVEEHMNTGEVAGFSTQIKD 2102 spotted gar
XP_014339601        2016 DLPAFAVGSLLLIPYSEKREQQIQGFLSLSNPETVLQQVVDHMTTGEVAGFASQIKK 2072 coelacanth
XP_012824467        2085 DLPAFTLGCLLLIPHMEKREQQIQGFLSTCNPETVLQQVADCMNTGEVAGFASQird 2141 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap