Conserved Protein Domain Family
Nrf1_DNA-bind

?
pfam10491: Nrf1_DNA-bind 
NLS-binding and DNA-binding and dimerization domains of Nrf1
In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human. Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein there is also an NLS domain at 88-116, and a DNA binding and dimerization domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity.
Statistics
?
PSSM-Id: 402218
View PSSM: pfam10491
Aligned: 13 rows
Threshold Bit Score: 351.324
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009031582  56 GPVGVAAAAAISTGKNR-KRPHSFEINPTVRKRQQTRLLRKLLATLSEYTTRVGQQAVLLCCTPG----K-TNPLy-YRV 128 Helobdella robusta
XP_002594375  38 GPVGVAAAAAIATGRKR-KRPHQFETNPSIRKRQQTRLTRKLKNLIDEYIIRVGQQAVVLCCTPG----K-PEGT--FKV 109 Florida lancelet
Q7PQW1        50 GVVGVAAAAAITSSKKK-KRPHSFETNPSIRKRQQNRLLRKLRQTIFEYATRVGQQAVVLVATPG----K-PNNI--YKV 121 Anopheles gambi...
XP_002115990  35 GPVGVAAAAAVATGRKR-KRGHTFETNPSIRKRQQTRLLRKMRDVLDEYTVRVGQQAAIICCTPS----K-PNEI--FKA 106 Trichoplax adha...
XP_011674777  39 GPIGVAAAAAIATGKKR-KRPHSFETNPSIRRRQQTRLIRKLKATIDEYATRVGQQAVVLTCTPG----K-HDGN--FKV 110 purple sea urchin
XP_003383083 351 GPVGVAAAAAILSGRKR-KR-HVFECNPALRKRHCSKLMRKLKETLDELSTRVGLQACVVTYRPSskqeK-PEPA--FKI 425 Amphimedon quee...
XP_018671153  52 tmpGLAAAAALVTSRKR-HQPYAFELNPSIRKRQYNRLLRKLKQTIHELCTRCGQQAVVLCVSPG----K-ENGG--FRV 123 vase tunicate
EKC38533      63 GTIGMAAAAAIASGKKHiKRPHAFETNPSIRKRQQTRLLRKLKACIEEYTTRVGQQAVVLCCTPG----K-SQNSnnYKV 137 Pacific oyster
XP_009015281  48 GPAGLAAAAAIASGKKR--RNHSFEMNPCTRKRQQTRLMRKLYSLMEEYIVRVGQQAVIICCSPG----KdAQSPssFRV 121 Helobdella robusta
XP_012931958  75 GPVGMAAAAAVATGKKR-KRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPS----K-PNPV--FKV 146 naked mole-rat
2_pfamImport   1 -PVGMAAAAAVATGKKR-KRPHVFESNPSIRKRQQTRLLRKLRTTLDEYTTRVGQQAIVLCISPS----K-PNAV--FKV 71 
1_pfamImport   1 GPVGMAAAAAVATGKKR-KRPHVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPS----K-PNPV--FKV 72 
XP_001625750  52 GPVGVAAAAAIATGKKR-KRPHSFETNPSIRKRQQTRLLRKLRATIDEYTTRVGQQAIVLCVCPG----K-PNPL--FKV 123 starlet sea ane...
XP_009031582 129 FGSQPLEDVLKEEKSVILADLDNKLALQAPh--KSSDKDFNKHELPPLNVEGIPTPIDKMTQAQLRMFIPEMLKYSTCR- 205 Helobdella robusta
XP_002594375 110 FGASPLDSVVRKADHVIMQDLEAALAQQAP---PPQSENPHLHELPPLVIEGIPVPVDKMTQAQLRAFIPIMLKYSTGR- 185 Florida lancelet
Q7PQW1       122 FGAKPLEDVLKNLRSNVMDKLDEALAAQAP---PRVQDDPSLFELPPLIIDGIPTPVEKMTQAQLRAFIPLMLKYSTGR- 197 Anopheles gambi...
XP_002115990 107 FGAKPLEDVLRNLKPVIMQNLDNALQQQAP---QVQQDNTGLFELPPLVCDGIPTPVDKMTQAQLRAFIPLMLKYSTGR- 182 Trichoplax adha...
XP_011674777 111 FGAAPLENIMRNLKGIVLQDLDNALAQRAP---QPSNENSDLYELPPLVIDGIPTSVNKMTQAQLRAFIPLMLKYSTGR- 186 purple sea urchin
XP_003383083 426 FGTSPLYGAIEEQKGRILNRMDEQLKKQIPptpPSSNKQSSSFELPPLVFEGIPTPVGEMTQAQLRGFIPTILKYSTGR- 504 Amphimedon quee...
XP_018671153 124 IGSSPLDSVVKNCKSAIYQELEQELQEKLGp--KREKTSDVLCDLPELLIEGIPTPVEKMNQAQLRMFIPEMLKHATGR- 200 vase tunicate
EKC38533     138 FGSQPLESVIRNCKSVVLQDLESTLAEQVP----QSQDLAGMQELPPLSIDGIPTSVDKMTQAQLRTFIPEMLKFSTGR- 212 Pacific oyster
XP_009015281 122 FGSQPLECVIKNRKWNILHNLEKSLTSQKN---QHIPENIGQFELPPLSVDGTLIGLERMTQAQLRYFVPEMLKHSTGK- 197 Helobdella robusta
XP_012931958 147 FGAAPLENVVRKYKSMILEDLESALAEHAPa--PQEVNS----ELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGR- 219 naked mole-rat
2_pfamImport  72 FGAAPLENVINKYENHILEHAHSRKIDQAPs--PQERGK----KIPSQIFNNIFNCATPRNEGRNLGFKKKTTRHKNGE- 144
1_pfamImport  73 FGAAPLENVVRKYKSMILEDLESALAEHAPa--PQEVNS----ELPPLTIDGIPVSVDKMTQAKLLLFPNSEYHRAVAKe 146
XP_001625750 124 FGAVPLENVIRNMKQLILPDLENALAEHAP---PQATENPDIPTLPPLVIDGIPTPVDKMTQAQLRAFIPMMLRYSTGR- 199 starlet sea ane...
XP_009031582 206 SKPGWGKEGLMPVWWPADVPWA-NIRCDVRSDEDKQKVSWTSALRQIVLSCYTYHDRLDLLP 266 Helobdella robusta
XP_002594375 186 GKPGWGKEATRPVWWPSDLPWA-NVRSDVRTEEQKQQVSWTHALRTIVKNCYKHHGREDLMM 246 Florida lancelet
Q7PQW1       198 GKPGWGRDSTRPPWWPKELPWA-NVRMDARTEDEKQKISWTHALRKIVINCYKYHGREDLLP 258 Anopheles gambiae str. PEST
XP_002115990 183 GKPGWGKESLKPAWWPKDLPWQ-NVRSDARSEEEKQRVPWTQALRDIIKSCYKHHGREDLLP 243 Trichoplax adhaerens
XP_011674777 187 GKPGWGKESCRPVWWPSDLPWA-NVRSDVRSEDEKRKVSWTHALRTIVINCYKHHGRDDLLP 247 purple sea urchin
XP_003383083 505 GKPGWGKEDMKPSWWPDDVPWQ-NVRSDVRNEADKKAMPWTDCLRKTIVACYTHHGRLDLLE 565 Amphimedon queenslandica
XP_018671153 201 GKPGWGKESTRPVWWPLDVPWA-NVRRDVRAPEVKIRVSWTQALRQIVKNCYRFHAREDLLV 261 vase tunicate
EKC38533     213 SKPGWGKVECRPVWWPGDVPWA-NVRSDVRTPEQKKKVSWTEALRTIVNNCYKHHGREDLLH 273 Pacific oyster
XP_009015281 198 SKPGWGKQEWRPVWWPKDGSWA-NIRSDTRTEEVKRMVPWTLALRKIVRNCYEYHNREDLLL 258 Helobdella robusta
XP_012931958 220 GKPGWGKESCKPIWWPEDIPWA-NVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLY 280 naked mole-rat
2_pfamImport 145 KNPGWGKMCCEQVRWPPRVTYK-GTLAAEKCENKAMQVSWTQALRTIVKNCYKQHGREDLLY 205
1_pfamImport 147 GSPLWGIKQYKPIYSPETRKWAnNLRKEPMTEIRNECRHWSGSLRRYSSKCYKQHGREDLLY 208
XP_001625750 200 GKPGWGKESTRPNWWPVDLPWQ-NVRSDCRSEEQKAKVSWTNALRQIVKNCYKYHGREDLLP 260 starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap