Conserved Protein Domain Family
CENP-F_C_Rb_bdg

?
pfam10490: CENP-F_C_Rb_bdg 
Rb-binding domain of kinetochore protein Cenp-F/LEK1
Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway. This domain is at the very C-terminus of the C-terminal coiled-coil, and is one of the key Rb-binding domains.
Statistics
?
PSSM-Id: 402217
View PSSM: pfam10490
Aligned: 8 rows
Threshold Bit Score: 84.0429
Threshold Setting Gi: 657531752
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002934738 2466 QRSTEHEEEFQPDGLPDVVQKGFADIPSGKQSPYILRRTTGPvRKSP 2512 tropical clawed frog
XP_002665261 2561 PKAKQDDEDFRPEGLPELVQKGFADIPVGEMSPFIVRRTTAQ-RCSP 2606 zebrafish
XP_005043131 2793 NLQGRNNTDCELDGLPEIVQKGFADIPSGKVSPYILRRTTLHlRSSP 2839 Collared flycatcher
NP_989976    2781 NLENQENSDYEPDGLPEVVKRGFADIPTERVSPYILRRTTLNlWTSP 2827 chicken
XP_014827232  217 gRGEQDDEEFRPEGLPDLVQKGFADIPLGEASPYIIRRTTGR-RCSP 262  Poecilia mexicana
TMS13343      209 PRTEQEDEEFRPEGLPELVQKGFADIPLGEASPFIMRRTTVK-RCSP 254  large yellow croaker
XP_008302449 1608 LSAAFDDTEYEPYGLPEVVMKGFADIPSGPSCPYIVRRGLLGtTVVP 1654 bicolor damselfish
XP_015207576 2713 QRTEEEDEEFRLEGLPEVVKKGFADIPSGEMSPYIIRRTTVQ-RCSP 2758 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap