Conserved Protein Domain Family
CtIP_N

?
pfam10482: CtIP_N 
tumor-suppressor protein CtIP N-terminal domain
CtIP is predominantly a nuclear protein that complexes with both BRCA1 and the BRCA1-associated RING domain protein (BARD1). At the protein level, CtIP expression varies with cell cycle progression in a pattern identical to that of BRCA1. Thus, the steady-state levels of CtIP polypeptides, which remain low in resting cells and G1 cycling cells, increase dramatically as Dividing cells traverse the G1/S boundary. CtIP can potentially modulate the functions ascribed to BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control. This N-terminal domain carries a coiled-coil region and is essential for homodimerization of the protein. The C-terminal domain is family pfam08573.
Statistics
?
PSSM-Id: 402211
View PSSM: pfam10482
Aligned: 19 rows
Threshold Bit Score: 124.402
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELK04390       4 FMESLNRLRDIHEREVLSLQNKLLELNSERCREARRVEELCAKNQQLREQQKALKENVRVLENRLRAGLCDRCSVTQELA 83   black flying fox
XP_008108369   6 FGDFLNKVKEIHEKEVHALQTKLNDITSERSQDAQRIEELFAKNHQLREQQKALKENVKVLENRLRAGLCDRCQVTQELA 85   green anole
XP_012786963  20 FKDLWTKLKECHDKEVQGLQVKVTKLKKERILDAQRLEEFFTKNQQLREQQKVLQETIQVLEDRLRAGLCDRCAVTEEHM 99   American pika
F1R983        20 LQELLTAVRDLHDTALQELQAKIAKLKKERCLDAQKLSEFHSKNQHLREQQKIQQEKIRQLEDRLRSGPCDRCTVKEKQI 99   zebrafish
XP_023182425  18 FEDVWRQLKVCHQNTVQEYQSKVSKLKNDRCLDAQKLEVFYNRNQQLKEQNKSLQDSISLLEDRLRVAECNRCAVLEEKL 97   southern platy...
XP_019218980  27 FQDLWRQLGECHQNALQELEAKVSKLKKERCLDAQRLEVFYNRNQQLKEQNKNLQDDMALLEERLRAAECDRCSILEENL 106  Nile tilapia
2_pfamImport   1 FEDVWKRLRELHQDALQDLEAKVSKLKKERCLDAQKLELFYKRSQQLKEQNKALQDTISLLEARLRSGDCDACAILKEAL 80  
XP_015209244  22 FSELLVRMKDCHDSEVQGLQIKISKLKKERCLDAQRLEEFYTKNQQLREQQKALQDNVKVLEDRLRAGLCDRCAVTEEHM 101  spotted gar
XP_010720728   6 FAEFLNKLKEIHEKEVQGLQTKLTELTTEKCRDAQRIEELFAKNHQLREQQKVLKENVKVLENRLRAGLCDRCMVTQELA 85   turkey
NP_766619      4 FMESLNRLKEAHEKEVLGLQNKLLELNSERCRDAQRVEELFAKNHQLREQQKALKENLRVLENRLRAGLCDRCMVTQELA 83   house mouse
ELK04390      84 RKKQQEFESSLVQSLQHVFVLTvtfaaNEMTRLQEENETLKQEV 127  black flying fox
XP_008108369  86 KKKQHEFGKAHFQSLQHIFILT-----NEVNKLREENKSMREEL 124  green anole
XP_012786963 100 RKKQQEFENIRQQNLKLITELM-----NEKNTLQEENKKLSEQL 138  American pika
F1R983       100 KKTNTELEDNNQRNLSVISELE-----AERKTLTDENRRLSLEL 138  zebrafish
XP_023182425  98 KSSQD-------QNLNVITKLK-----NENKNLEDENRNLQAEL 129  southern platyfish
XP_019218980 107 KNSQQ-------QNLHLIEKLK-----NERNLLEDENDKLRAEL 138  Nile tilapia
2_pfamImport  81 ETNQD-------QNQRLVTKLT-----NEKKILEDENRKLQAEL 112 
XP_015209244 102 KKKQVEFENVRQQNLRLITELM-----NERNSLQDENKKLCQQL 140  spotted gar
XP_010720728  86 KKKQNEYENSHFQSLQHIFILT-----NEMSRLKEENKILKEEL 124  turkey
NP_766619     84 RKKQLELENAHLQSLQHLCILT-----NEMNGLREENKILKEEV 122  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap