Conserved Protein Domain Family
ICAP-1_inte_bdg

?
pfam10480: ICAP-1_inte_bdg 
Beta-1 integrin binding protein
ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin. The cytoplasmic domains of integrins are essential for cell adhesion, and the fact that phosphorylation of ICAP-1 by interaction with the cell-matrix implies an important role of ICAP-1 during integrin-dependent cell adhesion. Overexpression of ICAP-1 strongly reduces the integrin-mediated cell spreading on extracellular matrix and inhibits both Cdc42 and Rac1. In addition, ICAP-1 induces release of Cdc42 from cellular membranes and prevents the dissociation of GDP from this GTPase. An additional function of ICAP-1 is to promote differentiation of osteoprogenitors by supporting their condensation through modulating the integrin high affinity state,
Statistics
?
PSSM-Id: 119000
View PSSM: pfam10480
Aligned: 2 rows
Threshold Bit Score: 373.256
Threshold Setting Gi: 82077465
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009181920   1 MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGqsNNNSDTCAEFRIKYVGAIEKLKLSEGK 80  olive baboon
Q5RG21         1 MFRKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSG--NAVSDASAEFRVKYVGAIEKLQFDMSK 78  zebrafish
XP_009181920  81 GLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTT 160 olive baboon
Q5RG21        79 TLQEPLDLINYIDAAQQDGKLPFVPGDEEMILGVSKYGVKVASLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTT 158 zebrafish
XP_009181920 161 DASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP 200 olive baboon
Q5RG21       159 DTKQQECSIWVYQCSSAEHAQAICKVLSSSFDCALASEKP 198 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap