Conserved Protein Domain Family
DUF2448

?
pfam10476: DUF2448 
Protein of unknown function C-terminus (DUF2448)
The family DUF2349 is the N-terminal part of this family. This protein is found in eukaryotes but its function is not known.
Statistics
?
PSSM-Id: 402209
View PSSM: pfam10476
Aligned: 20 rows
Threshold Bit Score: 213.01
Threshold Setting Gi: 1239905076
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015152637 190 KR-RETDKAYTQNLCssssttSITTPAQVIFLRFLAFLSCAFLVLLALYG----SSDPFSLNAavpaPVSSSP-AS--Vq 261 chicken
XP_006642159 191 RRgRDADKAFVQNSY------SFSTPTRVILLRVLAFLACAFLVALVTCG----SRDPFLTAGapeaPV----------- 249 spotted gar
XP_007246890 191 RRsRDADKAFIKSNY------PLSTPAWLVGFRTMAFLVCAFLVAVAVYGsgdlSSQPNSPQTlsggVPPP--------- 255 Mexican tetra
NP_001103936 189 RRtRDADKAFIKNTY------SLSTPAWLILLRILTFLACAFLVAVALSGyvdeS--PSVTQTlsggVVPP--------- 251 zebrafish
XP_005808284 191 RRsRESDSGFVKSSH------SLSSPTGVVLLRALAFLICAFLLTTFVYKlpeqPLSPNGPQTlsggVVPP--------- 255 southern platyfish
XP_023812301 196 RRtRESEGGFIKNSP------FLSSFTGVILLRVFAFLICAVLLATTFWDlp-dPVSSSETPTlsggVVPP--------- 259 Japanese medaka
XP_003444956 191 RRtRESDMGFVKSAQ------SLSSPMGVVLLRALAFLICAFLAATIFCElpdqPSSPDGSQTlsggVAPP--------- 255 Nile tilapia
3_pfamImport   2 RRsGESDKGFIKSSY------SVSSPFGVILLRTLAFLICTFLVATSLCDlpyqPASLSAPQTlsggVTPP--------- 66 
XP_014341613 189 lkcRGADKAYVQGFHf----tSIATPVRVIFLRFLAFLSCAFLVALAIYG----SGGPSFTENsssvRVEDSTgPL--V- 257 coelacanth
XP_010404307 169 RR-RETDKSYSQNLCssssstSITTPAQVILLRFLAFLSCTFLVLMALYG----SGDPFSLST----AIPAAVpSGpvRn 239 Corvus cornix c...
XP_015152637 262 -----nRTGTSshadLGNDTS-MTAAGWQELLHMLPEQMVENLSAAWDYGKNHQMAVAVLGLFTCLLAMFLAGRIRLRRI 335 chicken
XP_006642159 250 ------RPLASnasaPGNSSA-GSTGIWPELLSLFPREVLETLQAAWDYGRSHQLAVVCTGLLACIMAVFMAGRIRLRRI 322 spotted gar
XP_007246890 256 ------KRAMQnetdAKANNStKAEQMWNDLMGLLPEQAVENVKLIWQSGSNHQMAVASVGLLTCITGVLMAGPVRLRRI 329 Mexican tetra
NP_001103936 252 ------KRVLQneneSKTDEG---SLMWDDLMGLLPEKAVENARLFWQSGSDHQMAVASVGLLTCITGVLMAGPVRLRRI 322 zebrafish
XP_005808284 256 ------KPKSSnesaASNATD---LPVWQGLLDVIPEKAVENAKLVWQHGRDNQLAIVSVGLMTCLTAIFLAGPMRLRRI 326 southern platyfish
XP_023812301 260 ------KPKPHnestTNGSAN-GEMPMWQSVLELLPREAIENAKLACQYGAENQLAIVSVGLLTCLTAVFLAGPTRLRRI 332 Japanese medaka
XP_003444956 256 ------KPQVHnesaPTDNSS-RVLPVWQSLLELIPDKAIENAELAWQHGKDNQLAVVSVGLLTCLTGIFLAGAARLRRI 328 Nile tilapia
3_pfamImport  67 ------KPEPHnassPSNESG-GAVPVWQALLELLPDQLIGNTKLVWQHGKDNRLAVVSVGLLTCLTAIIFAGPVRLRRI 139
XP_014341613 258 ------NDANEtaeaSENANN-LSVTGWQDLITLIPEGVAGHMKVAWNYGQHHQMAVVSVGLLTCLLAVFLAGRVRLRRI 330 coelacanth
XP_010404307 240 rtgtspRAGggse---------gsvRGWRELLRLLPERVVENLSAAWAYGKNHQMAVAVLGLFTCLLAMFLAGRIRLRRI 310 Corvus cornix c...
XP_015152637 336 DAFASVLWFIVMSLHLAERYLKMETPSWLDTAKFGTTSLCCLVGFTAAVATRKSTGQRRYRPRRYF 401 chicken
XP_006642159 323 DAVASVLWLLVMGVHVLERYLETGAPRWLDAVKLGTTSLCCLVGFAAAVATRKSSGQRRSRARRYL 388 spotted gar
XP_007246890 330 DAVASFLWLLVLCLYFVECYLKTDIPDWLDTIKFSTTSLCCLVGFAAAVATRKPM--RRTRGRRYL 393 Mexican tetra
NP_001103936 323 DAVASVLWLLVICFYLAECYLKTDVPSWLEMVKFGITSVCCLVGFAAAVATRKSTSQRRARGRRYL 388 zebrafish
XP_005808284 327 DAIASVLWFVVLCLCLAESYL-TDMPSWMNSVTLVSTSLCCLVSLAAAAATHKPLGQRRARYRRYL 391 southern platyfish
XP_023812301 333 DALASVMWFAVLCLYLLERYF-SNALSWMDKAKLVTTSLCCLISFAAAAATRRPLGPRRGRYRRFL 397 Japanese medaka
XP_003444956 329 DAVASVLWFFILCLYMAESYM-TDALSWMYTTKLVGISLCCLVSFAAAVATRKPLGARRARYRRYL 393 Nile tilapia
3_pfamImport 140 DAVASVLWFLILSLYLAEGYL-TDAAGWMDTAKLAAASLCCLVSCAAALATRKPLGPRRARYRSF- 203
XP_014341613 331 DALASVLWLMVMGLHLTESYIEADVPNWLDTLKFCTTSLCCLVGFTSAVATRKSSGQRRYRPRRYL 396 coelacanth
XP_010404307 311 DAFASVLWFVVMSLHLAERYLKVDTPSWLDTAKFGTTSLCCLVGFTAAVATRKSTGQRRFRPRRYL 376 Corvus cornix cornix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap