Conserved Protein Domain Family
CENP-F_leu_zip

?
pfam10473: CENP-F_leu_zip 
Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway. There are several leucine-rich repeats along the sequence of LEK1 that are considered to be zippers, though they do not appear to be binding DNA directly in this instance.
Statistics
?
PSSM-Id: 402206
View PSSM: pfam10473
Aligned: 27 rows
Threshold Bit Score: 83.1196
Threshold Setting Gi: 768934991
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_014595150 2309 DEKKQLHTLGELKESRHHVDLLKDRVENLERELEISKEKQERVRLEAENSKAEVVT----LKVKIEEMAQSLRDLELDLG 2384 horse
XP_001510329 2151 DEKEKQHITGKLKESERKADSLQDKIEALERQLQMAEENQEAMILDAETAKMEAET----LKTKIEELTGRLQGLELEFG 2226 platypus
XP_002934738 1737 DEKKKNHLIGKLKETERNSDHLKDKIENLERELLMSEENLESTILQSESSKEEVEK----LKSMKEA-------LEANVN 1805 tropical claw...
XP_008124053 2017 DEKSKHRLAEKWKETQRKADSLVDKIESLERELQMSEENLEGAILQAEVAKEEAEA----ANAEIENMRVTLQRLEHEIS 2092 green anole
XP_014345462 2253 DEKKRHHEAEKLKASERKADSFQDKVEKLQRELQMSEESLEGMVLEAETVKEEMEK----LVTVKQEISKKLQILETEVN 2328 coelacanth
5_pfamImport    1 WDEKFLQQESELKRVRSEKANLEQHILGMESELETLQGEKSKLGSAMETQRKACSS----MEQQIETLRTETTQLRSELV 76  
NP_989976    2128 DERKKRHIAEKLKENERKSDALLDKVERLERELEMSEENLEDAVVQLETAKAEAET----FITEKEEMAEKLKCLQSQID 2203 chicken
XP_011607922 1774 WDDKFLQQESELKRVRSEKSNLEQHILGMESDLENLQEERTKLKTEVETQRKVCSG----MEQEIDTLRTELTQLRAELV 1849 torafugu
XP_011607920 2013 DERKKKKMRELLKAAQRKSDSLQDHIDALVREHADIESSLEEAVLQAETSKEELEEerrkVEEEKMVLSNKLSEFSIALQ 2092 torafugu
XP_018522411 2058 DERKKRKMGELLKAAQRKSDSLQDRIDALEREKEDVEQSLEEAVLEAETAKAELEEerrkVEDEKQRLSEKLSELSATLE 2137 barramundi perch
XP_014595150 2385 NIR-------SEKENLTKELQKEQGRVSELEVLNCSFENLLQEKEQE---KVEMKEESKIAVEMLQTQLKELNE 2448 horse
XP_001510329 2227 ALRlekenviEEKETIAKDLQEKQDRMSELESCNSSFEKLLENKEQE---IVRMEEESKNAIELLQVQLKDLKD 2297 platypus
XP_002934738 1806 TFR-------RRIVDLERELEKSKERIEELETRVLTLSNALEKSEME---KSCLNEESGQELLLLRAQLNELQE 1869 tropical clawed frog
XP_008124053 2093 ALK-------SEKVCLESMLEEKQVKVSSLESSHVVLLKQVKEEEQK---MVKIRGEYERELLSMQSQLNQAHE 2156 green anole
XP_014345462 2329 TLS-------SERDLLDKELQQKQLKISELEGSCMDITNLLKKVEEE---KLQVMQEHVVSQKALKSELMELNE 2392 coelacanth
5_pfamImport   77 LCT-------EERDELNQSLGQSREKVHSLEKSNCDTRNLISILEDDiraDKKEYDSLQSSMQELKIERQQLLE 143 
NP_989976    2204 DLT-------SQKECLAKDSKEKQERILELESSNLTTAKLLEEKEEE---KMQIKDEFENAVLLLKSELKGMSE 2267 chicken
XP_011607922 1850 SCS-------EERDDLNQSLGQWRNKVDTLERTNCDTRNLISILEDDirtGRREHKVLKTSIEELASEKQQLLE 1916 torafugu
XP_011607920 2093 HLR-------SEKKHV--ELELKNREIEDLKAAKEDMERGLERAEAG---K-RQKeerqkhrveqlekevkeda 2153 torafugu
XP_018522411 2138 NLR-------SEKERMERELEAKNREIEELKAAKEQLERGLEKAEVD---RRQEEERQKYRVEELEKGMREEAQ 2201 barramundi perch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap