Conserved Protein Domain Family
CReP_N

?
pfam10472: CReP_N 
eIF2-alpha phosphatase phosphorylation constitutive repressor
This is the conserved N-terminal domain of CReP, constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, catalytic subunit. It functions in the dephosphorylation of eIF2-alpha under basal conditions in the absence of stress. In response to translation inhibition, there is reduced synthesis of the labile CReP that contributes to elevated levels of eIF2-alpha phosphorylation. The C-terminus, family PP1c, is shared with the apoptosis-associated protein Gadd34 and herpes simplex virus.
Statistics
?
PSSM-Id: 371074
View PSSM: pfam10472
Aligned: 11 rows
Threshold Bit Score: 584.856
Threshold Setting Gi: 1022984228
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003792288   1 MEPGTG-GSRKWSAPRAGSRFWLPfFF-SRQSLPGSSKFPTPSDPENFRDTTLLSPAQPEARTRYWTKLLSQLLAPLPSL 78  small-eared galago
XP_005330361   1 MEPATH-GWRKQSAPPAGSWFRLP-FF-PRRSQAGFSKFPVRPAPENSGEPTPPSSSQPEARTSYWAKLFSPLLSPLPSL 77  thirteen-lined ...
EHB10534       1 MEPWTQ-GSRQGAAPRAGPWFRPPfFF-PGRSRAGASQFPTPPVPENSGGPTRLASAQPGARTNSWTKLLSQLLAPLPSL 78  naked mole-rat
XP_003474851   1 MEPGTP-GSRKGAAPRAGPWFRLP--F-SWRSRAVASHFLAP-VPEHRGDPTLLSSAQPEAQTSSLAKLLFQLLALLPSL 75  domestic guinea...
Q8BFW3         1 METGTH-RARKRPGPRLGSWFRLP--F-LRRSHACSSEFPPPSSRQNPGN-----SALPERRTRYWTKLLSQLLALLPSL 71  house mouse
XP_016285583 197 MEPGAQrGPREQPASAAVSWFRLPfFVrPHRAQSAAC---APCSAPSAGE----KSADPGRQARAWLALLSQFLAPLPGL 269 gray short-tail...
Q5SWA1         1 MEPGTG-GSRKRLGPRAGFRFWPP-FF-PRRSQAGSSKFPTPLGPENSGNPTLLSSAQPETRVSYWTKLLSQLLAPLPGL 77  human
XP_023404070   1 MEPGAD-RSRR----RAGARFRLPfLF-PWPSRPGSSKFPTPVAPESSGDPK-LASSPPQARTSYWMKLLSQLFAPLPSL 73  African savanna...
XP_005656728   1 MEPAED-GSRDRAAPRPRSRFRLP-FF-PWRSRAGTSKFPAPPAPGHSGDPRQASCPLPEARSSSWMQLLSQLFAPLPGL 77  pig
XP_006942964   1 MEPAAD-GSRPRPASRPGSRIRLPfFF-PRRPQPGTSKLPTPPAPEHSGDPRLAASPQP--RTSYWVKLFSQLFAPLPSL 76  domestic cat
XP_004756450  69 MEPAAD-GSR----PRPGSRFWLLsFF-PRRSQPRPSKLPTPSAPEHSGDSRLAAAPEPQARTGYWMKLLSQLFAPLPGL 142 domestic ferret
XP_003792288  79 LQKLLIWSQIqLSGLIPTRWLDFSAGYSALRALKGREEVADPTTE-KSLSSLRFN-SSDYSVASPLDWLEEGIHWQCSSP 156 small-eared galago
XP_005330361  78 LQKLLIWIQL-FSGIIPTRWLDFAGGYSALRALRGREATAAPAGQ-KTLSSLRLD-PSDSTVASSLDWLEEGILWQCSSS 154 thirteen-lined ...
EHB10534      79 LQKLLMWGQL-FGGLIPTSWLDFVGGYSILRALRGREEVAAPTVQkKSESLLRLD-LSDGSVTSPFDWLEEGIPWQCASS 156 naked mole-rat
XP_003474851  76 LQKLLTWSQL-FGGLIPTRWLDFAGGFSLLRALRGREDAAAPAAKkKSVSLLHPD-LSDSSADSPFDWLGERDLWQCASS 153 domestic guinea...
Q8BFW3        72 FQKLLLWSQL-FGGLIPTRWLDFAASYSALRALRGREESAAPTVQ-KSLSSLRLD-SSEDLVVSSLDWLEEGLQWQCSSS 148 house mouse
XP_016285583 270 LQKLLLWGQL-LGGMIPSRWLELASGKRVLRG-RGDDPTAVPVTQ-KAAS---FDcPPDDPTAAPLKWLEEGIHWQCGSS 343 gray short-tail...
Q5SWA1        78 LQKVLIWSQL-FGGMFPTRWLDFAGVYSALRALKGREKPAAPTAQ-KSLSSLQLD-SSDPSVTSPLDWLEEGIHWQYSPP 154 human
XP_023404070  74 FQKLLIWSQL-FGGLSPTRWLEFAGGYSALRALRGRDEPAAPIAQ-KSVSSLRLD-LSDDSAASPLDWLEEGIHWQCSSP 150 African savanna...
XP_005656728  78 FQKLLIWSQL-FGGMIPTRWLDFTGGYGALRALKAREEPAAPTAP-KSL--LRFD-PSADAAANPLDWLEEGIHWQCSPA 152 pig
XP_006942964  77 LQKLLVWSQL-FGEMVPTRWLDFAGGSSALRALKAREDPAAPPAQ-KSLSSLRLD-PSDDSGASPLNWLEEGIHWQCSSL 153 domestic cat
XP_004756450 143 LQKLLIWSQL-FGGLIPTRWLDFAGGYSALRALKAREDPDGPPAQ-KSLRSLRLD-PSDDSAASPLDWLEEGIHWQCSSS 219 domestic ferret
XP_003792288 157 HLELDLKTRGNALDRAVHVLLLE-QQLWK-VELLPSGLQSHMYSDRELGSSPSGPLSVQRLGNFNVVSYLLNSTSLDGLP 234 small-eared galago
XP_005330361 155 DLELELKAQGKTLDPAAHAFLLE-QQLWG-VELLPGSLQARLFPDREPGSSPSRSLSVQRLGNFNVVSYVLNPIYHDCLP 232 thirteen-lined ...
EHB10534     157 DLGLGLKAKRRALDPSAHAFFLE-EQLWS-VELSPSGLQARLFSDGEVGSSPSGPLNVQRLGSFSVVSYLLHPSHLDCLG 234 naked mole-rat
XP_003474851 154 GLGLGVKSKGGALDPSAHAFFLG-QQQWG-MELLPGGLEARLFCSREVGSAPSGSLNVQRLDSFSVVSYLLRPSYLDCLA 231 domestic guinea...
Q8BFW3       149 DLELKLKAQERALDSAAPTFLLE-QQLWG-VELLPSSLQAGLVSHRELDSSSSGPLSVQSLGNFKVVSYLLNPSYLDYLP 226 house mouse
XP_016285583 344 DLGLELEGKGGPLDPATHSLLLQ-QQLWG-AELVQSSLQAHLFPDKELCSTANGALNLEPFNNFNVVSYVLNPAGLNCLS 421 gray short-tail...
Q5SWA1       155 DLKLELKAKGSALDPAAQAFLLE-QQLWG-VELLPSSLQSRLYSNRELGSSPSGPLNIQRIDNFSVVSYLLNPSYLDCFP 232 human
XP_023404070 151 DLELALTAKGRALDPAAPAFLLE-QQLWR-VELLPSSLQAQLL-NRELGSSPSGPLNIQRLGNFNLVSCWLNASYLDCLP 227 African savanna...
XP_005656728 153 DLALELKAKGRALESAAHAFLLEqQQLWR-LELVPGSFQASLISDRELGPSPSEPLNVQRLSNVNVVSYLLNSSYLDGLP 231 pig
XP_006942964 154 DLTSELKAKAGALDPAAHAFLLE-HQLWG-VELLPSGLQGHLCSDRELGSLPSGPPNVKRVGSFSVVSYLLNPSYLDSLP 231 domestic cat
XP_004756450 220 DLELGLKAQAGVLHPGVHAFLLE-PQLWGaVELLPSGFQGHLCSNRELGSPPAGPLN-RRLSSFSVVSYLLKPAYLGCLP 297 domestic ferret
XP_003792288 235 QLELSYQNSVGSGELVDFQELTPEYSCLIE-DDCLPQPLNAEISPASWQGCP---PLSREGLPEIHHLRMKRLEFLQQAS 310 small-eared galago
XP_005330361 233 RLELGCQNSAGSGELVDFQALIPESSCLFE-DHCPPQPLRAEISAASWQGCP---PLSREGLPEIQHLRMKRLEFLQQAS 308 thirteen-lined ...
EHB10534     235 GLELSCQDGTEGSELVGFQTLTPESSCLSK-DCCHPEPLSAEISAPSWQGYP---PLSREGLPEIHHVRMKRLEFLQQTG 310 naked mole-rat
XP_003474851 232 ELELSCENGPGRTELVGFQTLTSESSCLSE-NPCHSQSLSAENSAASWQGYP---PLSRGGLPEIHHVRMKRLEFLQQTG 307 domestic guinea...
Q8BFW3       227 QLGLRCQSSAGGGQFVGFRTLTPESCYLSE-DGCHPQPLRAEMSATAWRRCP---PLSTEGLPEIHHLRMKRLEFL-QAN 301 house mouse
XP_016285583 422 HVELTCQKSFESSERGDLQTLTLESCFLAAdQSHQPQPLNAESSGSTWQGFPhksPLSKEGLPEIHHLRMKRLEFLQQAS 501 gray short-tail...
Q5SWA1       233 RLEVSYQNSDGNSEVVGFQTLTPESSCLRE-DHCHPQPLSAELIPASWQGCP---PLSTEGLPEIHHLRMKRLEFLQQAN 308 human
XP_023404070 228 RLELSYQNSVGSGQLVDCQIWTPESSCLID-DHCHPKPLNAEVTKASWQECP---PLSTEGLPEIHHLRMKRLEFLQQAG 303 African savanna...
XP_005656728 232 RVELSYQSSAGRGKLVDFQALSPESGSLDEvLSSHPQPLNAEIAHASWQECP---PLSREGLPEIHHLRMKRLEFLQQAS 308 pig
XP_006942964 232 RVGLGYQSGVGSGELVDFQTLSPESSCVTE-AHDPPQPLKAEITCASWRGCP---PLSREGLPEIHHLRMKRLEFLQQAS 307 domestic cat
XP_004756450 298 RVGLVYQNGVGSGEPVDFQTFSAEGSCRTE-DRDPPYPPKAEIACPSRQGRP---PLSKEGLPEIHHLRTKRLEFLQQAT 373 domestic ferret
XP_003792288 311 KGQELPTPDQDNGYHSLEEEHSLLRMDLKH------CRDNTTQFVPPAGAIPGTTQEL-TEEKIELLTREIPHALEKQSP 383 small-eared galago
XP_005330361 309 KGQELPSPDQDNGYHSLEEEHNLLRLDLNH------RTDNPTQPVPLEQAIPGTTQEP-REEKIELLTKEVPLGLEKQNP 381 thirteen-lined ...
EHB10534     311 KGQELPTPDQDNGYHSLEEEHCLLRVDVKH------RPGTPTQSVPLAGAASGNNQEP-GEEKI--LTEEVPLALERQGP 381 naked mole-rat
XP_003474851 308 KGQELPTPDQDNGYHSLEEEHG-QRVDVKH------SAGIP------AGAVPGNNQGS-GEEKRELLTEEIPLALEEQGP 373 domestic guinea...
Q8BFW3       302 KGQELPTPDQDNGYHSLEEEHNLLRMDPQH------CTDNPAQAVSPAADRP----EP-TEKKPELVIQEV-----SQSP 365 house mouse
XP_016285583 502 KGQALPTPDQDHGYHSLEEEHNLLRIDLSQalksgcCSESLGQCVPGSEALVEGSEDPtAEKKIGLLITEIPSLLAKQDS 581 gray short-tail...
Q5SWA1       309 KGQDLPTPDQDNGYHSLEEEHSLLRMDPKH------CRDNPTQFVPAAGDIPGNTQES-TEEKIELLTTEVPLALEEESP 381 human
XP_023404070 304 KGQTLPTPDQDHGYHSLEEEHSLLRIDLQH------CRENPAQFVSPAEAIPGTSQEV-TEENIELLTEEALHALEKQDP 376 African savanna...
XP_005656728 309 KGQGLPTPDQDHGYHSLEEEHSLLRMDLKH------PRDSPTQCIP----VPGTAQEP-TEEKIELLTEEVPLALERHDS 377 pig
XP_006942964 308 KGQALPSPDQDHGYHSLEEEHSLLRMDPQP------GGDSPTQCVPSAGAVPGTAQKPgTEEEVALVTTEDPLAVEKPGP 381 domestic cat
XP_004756450 374 KGQALPTPDQDHGYHSLEEEQNLLRMDLKS------GGDSPTLCVPSVGSLPETAQEP-TEGRIASLTTEVPVSLEEPDP 446 domestic ferret
XP_003792288 384 LESCPSCEVPMVKEPREDQISVVDYSCKD 412 small-eared galago
XP_005330361 382 SGSCPSCEVPEEREPEEDQVSVVDSSDIE 410 thirteen-lined ground squirrel
EHB10534     382 SGSLPSVEVPVEEEPGEDGASVVDSSDIE 410 naked mole-rat
XP_003474851 374 LGSFPSVEVAVEKEPGEDQVSVVDSCDIE 402 domestic guinea pig
Q8BFW3       366 QGSSLFCELPVEKECEEDHTNATDLSDRG 394 house mouse
XP_016285583 582 TDNWTTCNPSLERNIVGIQQNVVDSSDTE 610 gray short-tailed opossum
Q5SWA1       382 SEGCPSSEIPMEKEPGEGRISVVDYSYLE 410 human
XP_023404070 377 LGSCPSCEISVVEEPGEDQVCGVDNSTLE 405 African savanna elephant
XP_005656728 378 SESCASCEFPAEQEPGEDQISVVDNSDIE 406 pig
XP_006942964 382 SEGCPSREVPVEKEPGEDQISVVDSSDLE 410 domestic cat
XP_004756450 447 LEGRLSGEIPVEKEPGEDQRSVGDSSDLE 475 domestic ferret
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap