2JTO


Conserved Protein Domain Family
Inhibitor_I68

?
pfam10468: Inhibitor_I68 
Click on image for an interactive view with Cn3D
Carboxypeptidase inhibitor I68
This is a family of tick carboxypetidase inhibitors.
Statistics
?
PSSM-Id: 402203
View PSSM: pfam10468
Aligned: 2 rows
Threshold Bit Score: 105.841
Threshold Setting Gi: 194319910
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JTO_A    1 NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWL 74  Rhipicephalus bursa
ABO93460 22 NDCVSHGFGCTPESRCPPELRLSYTGCDTVCCDISRLTGCENKGGECQPREKPCRELPSENVSCSEEQKCCVLL 95  longhorned tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap