Conserved Protein Domain Family
Stn1

?
pfam10451: Stn1 
Telomere regulation protein Stn1
The budding yeast protein Stn1 is a DNA-binding protein which has specificity for telomeric DNA. Structural profiling has predicted an OB-fold. This domain is the N-terminal part of the molecule, which adopts the OB fold. Protection of telomeres by multiple proteins with OB-fold domains is conserved in eukaryotic evolution.
Statistics
?
PSSM-Id: 371062
View PSSM: pfam10451
Aligned: 5 rows
Threshold Bit Score: 274.846
Threshold Setting Gi: 121743395
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001646308   3 IGEK--------VSFYDRRYWKYCesydtcyvPLLISDINCridsskrvcndI--YGGLIGDVLFWGNRPLVKICVIGCV 72  Vanderwaltozyma...
Q0E7J7         1 MLENen-----qLTHQFPTLSRWN--------PMFISDVHK-----------IsfHPHLQRYIGFWMGFPIRWIQIVGYI 56  Schizosaccharom...
Q74ZP7        11 YETLdeagrrivVPFFHPTLLVLSeyfd-nitNCFIKDIRQrlalsrrvghlYqrYIPTQQLIVWYLNHPVRRIKVQGCV 89  Eremothecium go...
Q6CTL1         8 YETSkhg---srYPVFLTQLLPTSkwyg-katSLTIRSIYKnletsrkwnteYliYNSSIRDIFLYLNHPITSIKICGLV 83  Kluyveromyces l...
Q6FM89         3 HGEL--------VSEYRCYSERVSrglyhaevCMTVRMLHScld---------qsHARVLGGKLYWKNRAIRRLKFVGTV 65  [Candida] glabrata
XP_001646308  73 IGWRWKwirnEEYLIIKIDDSSDKhgFLDCKCSKSVLLSSGIVISNG-IGMTLKLFGKVG-------LRYCEFNITFME- 143 Vanderwaltozyma...
Q0E7J7        57 AAIDIY----EGKHVLTVDDCSGM--VLRVVFIIQDDFSMSKRAISMsPGNVVCVFGKINs-----fRSEVELIAQSFE- 124 Schizosaccharom...
Q74ZP7        90 VGYGWHrqagVDWMFLHIDDCTG---LMWCQCDEE----LAGEATAL-VGRTVAVSGYMNptgridrPSELYLVVEHLE- 160 Eremothecium go...
Q6CTL1        84 VGWKWKlignEDRAFWYIDDCSD---TILCQCSKSQLLALNCPLVDM-SGWTLILTGLLD-------QERVEFKVTQIE- 151 Kluyveromyces l...
Q6FM89        66 IGVKYMwlkgDDYAVIHLDDSSDSs-ILKCKCEVNQLNSFGININAGfIGSRVEVCGVYN-------TEFNELEVGFIGv 137 [Candida] glabrata
XP_001646308 144 YTDGLVSEVNHWRSSIQQRVLLQNPWEFDGLKYqeeeekegeveereenvttSHPRITNNqi--ivSSSPIEQ----KNF 217 Vanderwaltozyma...
Q0E7J7       125 ELRDPNDEWKAWQKRMRYKKNLTKISKNHHSII-------------------RTPKKSYF------PKDHAKEllkcIRQ 179 Schizosaccharom...
Q74ZP7       161 YVVGLESEIQFWEVTMLFRRQLGYVWELGPDLLnglysarrkaaveadgaprQAPTSESNcg---dDAASCKSlqpaASI 237 Eremothecium go...
Q6CTL1       152 VVKNLKHEIDFWSEAFDNQKELAIPWEIDPESLnefy-----------rgkqHTPSKSNSn-----LGNYIEQlqtiHFQ 215 Kluyveromyces l...
Q6FM89       138 LPSTLFSEIEHWRKCCLL---LRMPDDLTDEELkasgigd-----demqdgrDSPLDEYFstppqnKAQFIEKlv-lRDV 208 [Candida] glabrata
XP_001646308 218 NDPLEIASPYREIEE-SMYDNGEISVIMLDSTDPVEVE 254 Vanderwaltozyma polyspora DSM 70294
Q0E7J7       180 MCKLNVQAGFTIEEL-IIYLKAKELHLPLVHIFNVENE 216 Schizosaccharomyces pombe 972h-
Q74ZP7       238 EGSAYVPCAPVARAA-----------TTVTVRYTMNQY 264 Eremothecium gossypii
Q6CTL1       216 ENELLLASPYNGHVStGMGVWNSDLLQSTLEQDLIEQS 253 Kluyveromyces lactis
Q6FM89       209 KDKLEITSPDPVRNE-SISVVDDTCDNTTLGSNTIDLR 245 [Candida] glabrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap