Conserved Protein Domain Family
RNA12

?
pfam10443: RNA12 
RNA12 protein
This family includes RNA12 from S. cerevisiae. That protein contains an RRM domain. This region is C-terminal to that and includes a P-loop motif suggesting this region binds to NTP. The RNA12 proteins is involved in pre-rRNA maturation.
Statistics
?
PSSM-Id: 371055
View PSSM: pfam10443
Aligned: 17 rows
Threshold Bit Score: 536.503
Threshold Setting Gi: 1376262501
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KIS68234  394 RRQSAETIQEWIREKPSTFVTISGPRGSGKTGLV-NRVITRDVQ-------HLVIDCDVIAKtAKNDSLLIDALANETGY 465  Ustilago maydis 521
Q1E4N0    373 RKEDIQRLQTWLLEATNTFTVVHGPRGSGKKELVlDEVLKGYRH-------KLVIDCKPIQE-ARGDSATINAAAAEVGY 444  Coccidioides immi...
Q873L8    380 RKDLIDSIQTGLLESVDTFTVVHGPRGSGKKELIlDQVLKERSN-------VLHIDCKPVVE-ARGEAGTIGRLAFEVGY 451  Neurospora crassa...
Q6C542    400 RLSAIEDVKQWLQENVNTFIVVNGPRGSGKQELVmDYVLADRKTngggrgkILSIDCADLVK-ARNDPEFITTAAHQLGY 478  Yarrowia lipolytica
Q751P7    345 RVEKVNDLKMWLEENNNTFVVVTGPRGSGKHELVmQHTLHDRPN-------VLYLDCDTLIK-SRTDSKFLRNAAHQIGY 416  Eremothecium goss...
Q6CTB6    348 RQEKVADLKLWLQENNNTFVVLRGPRGSGKHELVmQHTLHDRPN-------VLYLDCDKLIK-SRTDAKFLRNAASQLGY 419  Kluyveromyces lac...
P32843    364 RIEKVNDLKMWLEENNNTFVVIRGPRGSGKHDLVmQHTLQNRAN-------VLYLDCDKLIK-SRTDPMFLKNAASQLGY 435  Saccharomyces cer...
Q6FIK2    361 RIEKMDDLKMWLEENNNTFVLIRGPRGSGKHELVmQHTLHNRNN-------VLYIDCDKLIK-SRTDAKFLRNAAGQLGY 432  [Candida] glabrat...
Q5A061    390 RYEKSKQLQLWIMENANTFIIVKGPQGSGKEEFVlEHSLGSDERln---kkVLVLECDQLGK-ARSDNNLINTTASQLGY 465  Candida albicans ...
Q6BKQ1    367 RFEKIKQLKLWIYENINTFIVVKGPKGSGKEEFVlDHTLNNDEKlk---rkVLYIDCDALVK-ARSDNGLIKTTARQLGY 442  Debaryomyces hans...
KIS68234  466 WPVFSWLSSINNMIDLAAVGLiGSKAGFATPTDAQLKQILGVVTNALNHINEQTQkrivka---ekarlAAEKKQSasqt 542  Ustilago maydis 521
Q1E4N0    445 RPVFSWMNSISSLIDVATQTL-GANAGLSETLDSQLGHILQNTANALKKVALEKK--------------RWDGKDS---- 505  Coccidioides immi...
Q873L8    452 RPVFSWSNNISSLVDLAVQSTtGVKANFSENLESQVVKILQTTASALKQVGLSER--------------KKEDKDA---- 513  Neurospora crassa...
Q6C542    479 FPVFPWMNNISSFIDLAIQGLtGQKGGFSETTEAQFKSMLGIASAAIADIALSNH--------------NKEDHAKn--- 541  Yarrowia lipolytica
Q751P7    417 FPIFPWLNSVTTLVDLAVQGLtGQKSGLSESKETQFRNMLNTAMMSIRHIALSGYka----------tlHSGDDVT---- 482  Eremothecium goss...
Q6CTB6    420 FPIFPWVNSVTNLLDLAVQGLtGQKSGLSESKELQFRNMLSTAMMSIRHIALKGYkp----------viGSGDSII---- 485  Kluyveromyces lac...
P32843    436 FPIFPWIDSVTGVLDLTVQGLtGQKTGLSETKESRFRNMLTTSLMSIRRIALKNYka----------fvSTGDGTV---- 501  Saccharomyces cer...
Q6FIK2    433 FPIFPWIDSVTNVLDLMVQGLtGQKSGLSETKESQFRNMLTTSLMAVRRIALKDYqs----------tiNDAGDDV---- 498  [Candida] glabrat...
Q5A061    466 FPVFTWTNTVSRFVDLGVQGLtGQKSGLSESKETQIKNMFSLATQAIRKITTNEYnkyvksverrnkrlKDDEKIE---- 541  Candida albicans ...
Q6BKQ1    443 FPVFTWTNSISQFVDLGVQGLtGQKSGLSESKETQLKNMFSLTTQALRNIALSDY--------------EDYRNDTikqq 508  Debaryomyces hans...
KIS68234  543 lypapgvptvhngavgekeslgekaselaqntieslqhlVTCEDDSIAKKDKNTtfvsPVVVIKQFHHKGIK--QAILHQ 620  Ustilago maydis 521
Q1E4N0    506 ---------------------------------------HMTDEEFLEAHPECR----PVVVIDNFLYKANN--NPMIYE 540  Coccidioides immi...
Q873L8    514 ---------------------------------------DLSEDAYLEAHPERR----PVIVIDHFLHKSEE--KGVIYD 548  Neurospora crassa...
Q6C542    542 --------------------------------------qITRNSDYLQSHPDAK----PVVVIEHFLARTDR--NQFVYK 577  Yarrowia lipolytica
Q751P7    483 ---------------------------------------TVKEEDYLQQHPERK----PVIVIDRFSNKAEI--NGFVYK 517  Eremothecium goss...
Q6CTB6    486 ---------------------------------------NVKEEDYLQQHPEKK----PVIVIDRFNNRAEM--NGFVYK 520  Kluyveromyces lac...
P32843    502 ---------------------------------------NVKEEDYLQQHPEAK----PVIVIDRFEGKSEI--NGFVYK 536  Saccharomyces cer...
Q6FIK2    499 ---------------------------------------NIKEEDYLQQHPEAK----PVIVIDRFEGKADI--NSFVYK 533  [Candida] glabrat...
Q5A061    542 ---------------------------------------VLKEEQFLQQHPEAK----PIIVLNKYSRRADVssNDFIPP 578  Candida albicans ...
Q6BKQ1    509 krrtrkten-----------------ntdekpsisveeeIIKEEDYLQQHPEAK----PIIVVNNFQRKSDGn-NDMIYK 566  Debaryomyces hans...
KIS68234  621 VLAEWAAELVTNGIAHVVFVSDNpVGMGKELAKALPNVPFQGIALADAEEDKAQSYVYNKLKE----------------- 683  Ustilago maydis 521
Q1E4N0    541 KLSDWAAALTVSNIARVIFLTGD-ISYSKTLSRALPNQIFHEIQLGDCTPDVAKQFVLDHLHT----------------- 602  Coccidioides immi...
Q873L8    549 RIADWAAALVQSNIAHVIFLTDD-ASYSKPLQRSLPDRVFRSVTLGDLSPDVAKKFVISQLQT----------------- 610  Neurospora crassa...
Q6C542    578 HLAEWAASLIQSNTAHVIFITSD-VTFQKVLSAALPNQIFKTVHAGDASAQSARDFVKQQMDEfkkaieaarhlveenkh 656  Yarrowia lipolytica
Q751P7    518 ELADWASMLVQMNIAHVIFLTES-VSPNQLLAEALPNQVFKFLFLSDASKDSARSYVLSQLy------------------ 578  Eremothecium goss...
Q6CTB6    521 ELSDWAAMLVQMNLAHVIFLTET-VSPNQLLAESLPNQVFKMMTLSDASKKSARRYVLAQLq------------------ 581  Kluyveromyces lac...
P32843    537 ELSDWAAMLVQMNIAHVIFLTET-VASNQRLSESLPNQVFKNLILSDASKENSRNYVLSQL-E----------------- 597  Saccharomyces cer...
Q6FIK2    534 ELADWAAMLVQMNIAHVIFLTET-VAANQRLSESLPNQVFKTMILSDASKANSRNYVLSELVE----------------- 595  [Candida] glabrat...
Q5A061    579 LVADWASGLVQNNTAHVIFLTAD-VGSLQLLNDALPNQVFKDISLSDASMSSSRQYVCDVL------------------- 638  Candida albicans ...
Q6BKQ1    567 LIAEWTSSLVQSNMSHVIFITHD-VGSVQHLTDSLPNQVFKTISLSDASQRSAKQYVWNQL------------------- 626  Debaryomyces hans...
KIS68234      --------------------------------------------------------------------------------      Ustilago maydis 521
Q1E4N0        --------------------------------------------------------------------------------      Coccidioides immi...
Q873L8        --------------------------------------------------------------------------------      Neurospora crassa...
Q6C542    657 qkervealvdeepsleemlqhhrteleyerekreregkiddtldeiikeekvieerdraewdatsaaqredekvspfdpd 736  Yarrowia lipolytica
Q751P7        --------------------------------------------------------------------------------      Eremothecium goss...
Q6CTB6        --------------------------------------------------------------------------------      Kluyveromyces lac...
P32843        --------------------------------------------------------------------------------      Saccharomyces cer...
Q6FIK2        --------------------------------------------------------------------------------      [Candida] glabrat...
Q5A061        --------------------------------------------------------------------------------      Candida albicans ...
Q6BKQ1        --------------------------------------------------------------------------------      Debaryomyces hans...
KIS68234  684 ------MgrlpalggaapswhpayesNATRAQATAAEFAAAnadyttngsaaassepqyAPTLDDETASWVDKLGGRLTD 757  Ustilago maydis 521
Q1E4N0    603 ------D-------------------QSNSSSYTQAGPDTI------------------EGGDIKDLEDCIEVLGGRLSD 639  Coccidioides immi...
Q873L8    611 ------DtkfahdgqqkdsesgdqdnDNKNQK--------Kdsnt----------paplDPTLLKELDTCITALGGRLTD 666  Neurospora crassa...
Q6C542    737 estagvEaekeenktdgdgepatkdnGKSDEQNKNDTITSWkalippgt--deatlaeiPIPDLTDLDEALSPLGGRMTD 814  Yarrowia lipolytica
Q751P7    579 --------------------------PSSPAYSEKMPAADAd----------------aNEEYRKEIDRALEPIGGRMLD 616  Eremothecium goss...
Q6CTB6    582 --------------------------ETTEDDDDIDTSKPLd----------------lNEKFVHEIDDSLDPIGGRMLD 619  Kluyveromyces lac...
P32843    598 ------DylyynkkskgenvkepeseKETAENNDSDSEADTsvkka---------evilNEKELQEIDASLEPLGGRMLD 662  Saccharomyces cer...
Q6FIK2    596 ------Hyhkslkrak-kaeedepteKASPEHSQYD-ENDPrr--------------ylSEELIQDIDDSLEPLGGRMLD 653  [Candida] glabrat...
Q5A061    639 -----------------------------------------------------------KVKDTSTLDECLEPLGGRMLD 659  Candida albicans ...
Q6BKQ1    627 ----------------------------------NDPSLM----------------------NPDSLDKYIEPLGGRMLD 650  Debaryomyces hans...
KIS68234  758 LETLVQKVSLGQTVESAVQDIISRSVVELRKNAFGd-dSGEASSLPWTRSQAWTIVNKL---AKTGEVSYYGLLHNE-FK 832  Ustilago maydis 521
Q1E4N0    640 LEFFARMISRGQSPSDAVHDIIVQSAAEILKMYIA---DVDNTVRNWTPEQAWYLVSSLa-eAQGGSILYSEALFSDlFK 715  Coccidioides immi...
Q873L8    667 LQVLARRLKIGQSPRKAVQEIIDSTASDILRMFLLs--KSSTSDRKYTTEQAWYLISHLa-aSPSSSIPYNSVLLSNtFA 743  Neurospora crassa...
Q6C542    815 LQAFIRRLKSGDTPREALRGMITQSATEIVQMFLM------KDNAQWTKEQVWCLMKKVckdSGNGVSIADLMVTEPmFK 888  Yarrowia lipolytica
Q751P7    617 LQAFVRRVKSGEEPSEALEKMVEQASEQITQIFLS------ERSEPIKTAQAWELIELL---SQNDVVKYGDIVFRPlFK 687  Eremothecium goss...
Q6CTB6    620 LQAFVRRVKSGEQPKEALEKMVEQASEQITQIFLS------GSADPLRGAQAWELIELL---SANGSIRFRDIIYRPlFK 690  Kluyveromyces lac...
P32843    663 LQAFVRRVKSGEEPSEAVDKMIEQASEQITQMFLS------DKIDSNKSAQAWELIELL---SANPVIPFHEIVNKPlFK 733  Saccharomyces cer...
Q6FIK2    654 LQAFVRRVKFGELPKEALDKMIEQASEQITQIFLS------DKIDPLKSAQAWELIDLL---SKNGKVYFHDIVFRPlFK 724  [Candida] glabrat...
Q5A061    660 LQSFIRRIKSGESPQQAINEMISQAAELINTFFLNshhKFGAGDSNWDPSQVWLIMKLL---SECDTINYSELVKSPlFK 736  Candida albicans ...
Q6BKQ1    651 LQAFIRRIKSGESANDALSEMVNQASEQITTFFLNn-tVANESDSNWNTAQVWAIMKFL---SENDSFEYNELSKISlFK 726  Debaryomyces hans...
KIS68234  833 G--------NET--AIKSLEQAEIISVRHHDGRPSAIRAGRPVMQEAIKRLVSDRVFNDTQTLLANTGAIESAEKSLRTI 902  Ustilago maydis 521
Q1E4N0    716 Kd-------GES--TIRALEQAELISVTTLNDRPSTIKPGRPVFAAAFRRLLEDDVLRCRLGLRTLGQQIAMENANINKY 786  Coccidioides immi...
Q873L8    744 Ss-------PET--ALEALANAELITVKSQNGMPSEIKAGKPVYQAAFQKLASDEKVKARMDLLVLTELAKMETQKIEKV 814  Neurospora crassa...
Q6C542    889 GalkpqgesGES--TIGALERSEMVTVVTRDGKPTYIKAGKPLYRAAFQYILSDKTFSAMIETGFLESQMKLQNDKIVKY 966  Yarrowia lipolytica
Q751P7    688 Ss-------PEA--GLLELEKNGLITISRNRGVLQDIRPAKPLFKAAFSYLLQDKDLSIVLRTGYYLRLIAFETGRIKKW 758  Eremothecium goss...
Q6CTB6    691 Aa-------PEA--ALLDLEKNGFVTMTRDRGVLTDIYPAKPLFCAAFQYLLNNKEMYNVLRTSYLLRMVTFETGRIKKW 761  Kluyveromyces lac...
P32843    734 Aa-------PET--GIMELENNGLITVSRDRGVLQEIRPAKPLYRAAFTYLINDPELAKVLKTRYLLKVVGFETGRIKKW 804  Saccharomyces cer...
Q6FIK2    725 Aa-------PEI--GILELENNGLITVSRDRGVLKEIRPFKPLYRAAFQYLIDDEDLKTVLMTRYHLKVINFETGRIKKW 795  [Candida] glabrat...
Q5A061    737 Vs-------KETleILTTLEKYDLISLKRDKGVLDKISTGRPLFKAAFANIISDLRIWKLYETEYIGRLISLEAAKIQKL 809  Candida albicans ...
Q6BKQ1    727 Ss-------NETlaTLAALEKHDLISFTREKGVLSRISTGRPLYKAAFKELINDRKVYKLYETDYYNNLITIESTKIFKL 799  Debaryomyces hans...
KIS68234  903 EAEIADISKM 912  Ustilago maydis 521
Q1E4N0    787 EGELQVLGSL 796  Coccidioides immitis RS
Q873L8    815 EQELVMLQgl 824  Neurospora crassa OR74A
Q6C542    967 EEELRLLAKF 976  Yarrowia lipolytica
Q751P7    759 EEELRLLAKV 768  Eremothecium gossypii ATCC 10895
Q6CTB6    762 EEELRALGKV 771  Kluyveromyces lactis NRRL Y-1140
P32843    805 EEELKPLGKV 814  Saccharomyces cerevisiae S288C
Q6FIK2    796 EEELRALGKI 805  [Candida] glabrata CBS 138
Q5A061    810 EEELEKIYKI 819  Candida albicans SC5314
Q6BKQ1    800 EDEINKISRL 809  Debaryomyces hansenii CBS767
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap