2LXE


Conserved Protein Domain Family
WIYLD

?
pfam10440: WIYLD 
Ubiquitin-binding WIYLD domain
This presumed domain has been predicted to contain three alpha helices. The domain was named the WIYLD domain based on the pattern of most conserved residues. It binds ubiquitin. In the Arabidopsis thaliana histone-lysine N-methyltransferase SUVR4, binding of ubiquitin to this domain stimulates enzymatic activity and converts its activity from a strict dimethylase to a di/trimethylase.
Statistics
?
PSSM-Id: 402185
View PSSM: pfam10440
Aligned: 28 rows
Threshold Bit Score: 65.3482
Threshold Setting Gi: 1249674284
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LXE_A        45 KDEKVLKALERTRQLDIPDEKTMPVLMKLLEEAGGN--WSYIKL-DNYTALVDAIYSVEDE 102
ERN09744      11 GSRRVDAAIDALLPFGFSKSTITCTVNKLLKVYGGDsgWLFIEE-ASYRLLIDTILEDQEK 70  Amborella trichopoda
XP_004956318   9 GERRIDAAIDHLAEYGFPKPRIRKIINNLLQLYGRDg-WVFLEE-GSYKIVLDTLLEEQEQ 67  foxtail millet
XP_002464252   9 GERRIDAATDHLAQYGFAKPQIRNVIHDLLQVYGREg-WPFLEE-GSYSLVRNRLLEEQAQ 67  sorghum
XP_015696649  10 GGGRIDAAIDHFTPMGYAKPDIRAVVKQLLKLYG-DdgWPFLEE-GAYRVVQEALFEKQER 68  malo sina
XP_015696559  38 GERRIDAAIDHFIPMGYATSDIQTVIKQLLEVYG-KdgWRFLEE-DSYRVVQEALFEKQEy 96  malo sina
XP_003579758   7 RVGRMDAAIDHFTPMGYKETQVRSVVNSLLKVYG-NdgWPLLEG-DCYEVVQQELFKQEEE 65  stiff brome
XP_004956294  14 GDRRIDAAIDHFAAMGYAARDIRDAIADLLKVYGGPsaWPLLEE-GSYQVVQDKLFEKEDE 73  foxtail millet
EEF35512      10 GLKRIDAALDALRPMGFSPDLIRKTVQSLLKAYGGDegWPFLEE-NSYRLVIESILEELEk 69  castor bean
XP_002460399  11 GDRRIDAAIDHFTVMGYAARDVKAVVTDLLKVYGGPdaWPLLEEgGSYQVVQERLFEIEEK 71  sorghum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap