4RWO,4S3N


Conserved Protein Domain Family
OAS1_C

?
pfam10421: OAS1_C 
Click on image for an interactive view with Cn3D
2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
This is the largely alpha-helical, C-terminal half of 2'-5'-oligoadenylate synthetase 1, being described as domain 2 of the enzyme and homologous to a tandem ubiquitin repeat. It carries the region of enzymic activity between 320 and 344 at the extreme C-terminal end. Oligoadenylate synthetases are antiviral enzymes that counteract vial attack by degrading viral RNA. The enzyme uses ATP in 2'-specific nucleotidyl transfer reactions to synthesize 2'.5'-oligoadenylates, which activate latent ribonuclease, resulting in degradation of viral RNA and inhibition of virus replication. This domain is often associated with NTP_transf_2 pfam01909.
Statistics
?
PSSM-Id: 402171
View PSSM: pfam10421
Aligned: 95 rows
Threshold Bit Score: 294.382
Threshold Setting Gi: 664776402
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4RWO_A       163 KPNPEIYVQLIKECKSrgkEGEFSTCFTELQRDFLRNRPTKLKSLIRLVKHWYQTCKKTH--GNKLPPQYALELLTVYAW 240 pig
XP_003994783 168 qPPPEVYVSLIEAHGY---PGNFSPSFSELQRNFVKHRPTKLKSLLRLVKHWYLQYVKAKcpRAALPPVYALELLTIYAW 244 domestic cat
ELW63831     167 RPPPEVYASLIQAHRY---PGMFSPSFSELQRNFVKHRPTKLKSFLRLVKHWYQQYVQARcpRANLPPLYALELLTIYAW 243 Chinese tree shrew
Q8VI94       164 CPSSEVYANLIKANGY---PGNFSPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVRDKcpRANLPPLYALELLTVYAW 240 house mouse
XP_012997588 168 QLPPEVYVNLIKACRY---PGNFSPSFSELQRNFVKHQPTKLKSLLRLVNHWYQQYVIAKcpRANLPPPYALDLLTIYAW 244 domestic guinea...
DAA20578     169 QPSPEVYVRLIKACRT---LGYFSPSFSELQRNFVKYKPTKLKSLLRLVKHWYLEYVKAKcpRAELPPMYALELLTIYAW 245 cattle
NP_001026960 152 GPSAEVYVDLIEARKP---PGNFSPSFAKLQRSFVKHRPAKLKSLLRLVKHWYLKYVKARcpIARLPPLYALELLTIYAW 228 pig
XP_001091486 168 QPPPEIYVSLIKACGG---PGNFSPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVKARspRANLPPLYALELLTIYAW 244 Rhesus monkey
XP_023352840 173 KPSPEVYENLIKSRSK---PGEFSSSLSELQRKFFKHLPVKVKNLLRLVKHWYIKKVKAKcpGVFLPPKYALELLTIYAW 249 Tasmanian devil
XP_012397933 192 NPQSTVYEKLIKSRRC---PGEFAPSFSELQRNFVKHRPTKLKSFLRLVKYWYREYVKKKysGKHIPPKYALELLTIYVW 268 Tasmanian devil
4RWO_A       241 EQGSRKT-DFSTAQGFQTVLELVLKHQKLCIFWEAYYDFTNPVVGRCMLQQLKKP-------RPVILDPADPTGNVGGGd 312 pig
XP_003994783 245 EVGAQEDeSFRLDEGFATVMELLQEYDFLCIYWTKYYTFQNPLIKGFVRKQFKRD-------RPVILDPADPTHNVAEG- 316 domestic cat
ELW63831     244 EMGTQESeQFRLDEGLATVMELLQDYELLCIYWTKHYTFQHPVVGDFVRKQLKKK-------RPIILDPADPTYNVAEG- 315 Chinese tree shrew
Q8VI94       241 EAGTREDaNFRLDEGLATVMELLQDHELLCIYWTKHYTLQHPVIEACVRRQLRGQ-------RPIILDPADPTNNVAEG- 312 house mouse
XP_012997588 245 EMGTQQEkSFSLAEGLTTVMELLLDAELVCIYWTKYYTLQNPVIEGYVRKQLKKE-------RPIILDPADPTHNVAEG- 316 domestic guinea...
DAA20578     246 ETGTEEKeRFRLDKGLVTVLLLLTKYQRLCIYWTKYYTLQNPVIEDFVRNQLKEK-------RPIILDPADPTYNVATG- 317 cattle
NP_001026960 229 EVGTKAHeRFHLDRGLVTVMCLLQEYQSLCIYWTNYYKFQNPIIEDFVREQLKKE-------RPIILDPADPTYNVAYG- 300 pig
XP_001091486 245 EMGTEEDeNFMLDKGFTTVMDLLREYDVICIYWTKYYTLQNAIIEDCVRQQLKKE-------RPIILDPADPTHNVAEG- 316 Rhesus monkey
XP_023352840 250 EMGTQRAeYFRTEEGFITVMMLLQDYENICIYWTTNYNFGNAIVRDFVKNKLKKN-------RPIILDPADPTNNVGEG- 321 Tasmanian devil
XP_012397933 269 EIGKPNTnDFSLAEGFVTLMNLVKDYRNICIYWTVYYDFENQAVGHFLKRQLRYIpqtkekkRPIILDPADPTNKVGNG- 347 Tasmanian devil
4RWO_A       313 tHSWQRLAQEARVWLGYPCCKNLDGSLVGAWTMLQK 348 pig
XP_003994783 317 -YRWDIVAQRASQCLKQNCCYDDKENPVSSWTV--K 349 domestic cat
ELW63831     316 -GRWDIVAQRACQCLKQDCCYDSGENAVPSWNVQMA 350 Chinese tree shrew
Q8VI94       313 -YRWDIVAQRANQCLKQDCCYDNRDSPVPSWRVKRA 347 house mouse
XP_012997588 317 -YRWDIMAQRACQCLKQDCCYDSNDTPVPSWDVKRA 351 domestic guinea pig
DAA20578     318 -YRWDIVAQSARHCLKQSCCYDNNETCIPNWKLKFA 352 cattle
NP_001026960 301 -YRWDIVSQRARQCLKQCCCH-NNKSPVPPWYIKPS 334 pig
XP_001091486 317 -YRWDIVAQRACQCLKRVCCYDNRQNPVTSWNVKRA 351 Rhesus monkey
XP_023352840 322 -RRWDVLAQEAAHCLKQDCCYDENDEEIQSWDVQga 356 Tasmanian devil
XP_012397933 348 -YNWDLIAKEASYCLSQACSQLKDRMPISSWNVkga 382 Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap