1AQ5


Conserved Protein Domain Family
Matrilin_ccoil

?
pfam10393: Matrilin_ccoil 
Click on image for an interactive view with Cn3D
Trimeric coiled-coil oligomerization domain of matrilin
This short domain is a coiled coil structure and has a single cysteine residue at the start which is likely to form a di-sulfide bridge with a corresponding cysteine in an upstream EGF (pfam00008) domain thereby spanning a VWA (pfam00092) domain. All three domains can be associated together as in the cartilage matrix protein matrilin, where this domain is likely to be responsible for oligomerization.
Statistics
?
PSSM-Id: 402147
View PSSM: pfam10393
Aligned: 22 rows
Threshold Bit Score: 49.6324
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AQ5_C         4 MEEDPCECKSIVKFQTKVEELINTLQQKLEAVA-KRIEALENKI 46  chicken
NP_001315202 250 IVQDPCMCEARLAFQRQTQTSIQDLNAKLAAVT-RKIEQMENML 292 zebrafish
Q5NJJ7       256 LTENACMCEAQIAFQRKVHNSIQTLSSRLDDIS-NRVQQFDLRR 298 zebrafish
O42401       407 TDEEACKCEAIAALQDSVTSRLEALSTKLDEVS-QKLQAYQDRQ 449 chicken
XP_023351081 455 STQDACSCDATLAFQEKVTSYLQRLSAKLDDIL-EKLQVNDLRQ 497 Tasmanian devil
XP_003787470 400 STEDACGCEATLAFQDKVSSYLQRLNTKLDDIL-KKLQINEYGQ 442 small-eared galago
XP_012779431 249 VVEDPCKCEARLAFQKQTQAAIQQLAAKLADVT-GRIERLENTV 291 zebra mbuna
XP_023203292 296 VVEDPCKCEAMLVFQRQTQATIQQLTAKLADISgR-IEHLENTL 338 southern platyfish
XP_012397184 735 EKHDQCKCENLLTFQNFANQEVRKLTErLEEMT-RRMEVLENRL 777 Tasmanian devil
XP_005464972 758 sDENMCQCENVIMFQNQVTEKLKSLVQnIAAMS-KRLETLENQL 800 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap