5Y5A


Conserved Protein Domain Family
EST1_DNA_bind

?
pfam10373: EST1_DNA_bind 
Click on image for an interactive view with Cn3D
Est1 DNA/RNA binding domain
Est1 is a protein which recruits or activates telomerase at the site of polymerization. This is the DNA/RNA binding domain of EST1.
Statistics
?
PSSM-Id: 402132
View PSSM: pfam10373
Aligned: 50 rows
Threshold Bit Score: 95.943
Threshold Setting Gi: 3219909
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y5A_A        220 PLRYLDIASTIVPSVGETFLQRGICYTHTKNFGNAAYQFVRSSLSRLPS-DAGIPNFTNLLGDPNGSLFKKLLNSLDDLk 298  Kluyveromyces...
XP_002493917  230 CLECLNLAILLLPSQGDPHNHIGLIERLRRNDFNIIYNFARSTMTRIHS-PNGFMNLILHLSSEMLLNTVSRAILEPEK- 307  Komagataella ...
Q6FU90        234 SKEYFDLASLLLPSSGETYLQRGMVYIQTDNLGTAVQEFIKGSLAKSPC-PAALSNFKTIILENDSTLHLRLDKLILDVh 312  [Candida] gla...
EDO14661      222 SIRYFDMASLILPSVGETYLQKGMILISTENYGIASYEFIRSILSRIPN-LAGFSNLTKLLCDDKSSLRKRFESILLDTh 300  Vanderwaltozy...
CAR26928      226 SFRYLDLASLILPSIGEAHLQKGMINIQTDNLGNAIYEFTRSALSRIPS-PAGLTNFATIICEKDSNLRQRFDSVLKETh 304  Zygosaccharom...
XP_002554554  220 SMRYFNLATLVLPSVGEPYLQEGLIYVQARNFGFSTYSFARSALSRLPS-AAGLPNFLSSVCDPNSKIFTQVMIAFQDIf 298  Lachancea the...
EDK40214      253 SMNFYKLCIMLLPTLHEPYNHIGMIHNIVGNKVEACYWFLRSRFTRIPNyDLGLKNLESIMVKSWFQDQLGDAFKSK--- 329  Meyerozyma gu...
Q6BIA6        250 ALNFYKFCILLLPALNEPYNHIGMIYNLMDSKYDACYWFLRSQFTRLPDyKLGLTNLNTILRKDWFINHLISFNNPNK-- 327  Debaryomyces ...
EER30368      226 AIQYYNLCIMLIPALSEPYNQIGVIYNSVDDKFNAIYWFLRSHFSRLSEhQLGFANMSAILKKHWFTTALVDIVNGN--- 302  Candida tropi...
ABN64722      247 AIQFYKLCIVLIPALNEPYNHIGMICNTLNKQFEACIWFLRSTLTRIGNfQVGMNNFKSIIRKKPFVAKLNRINSDRFDg 326  Scheffersomyc...
5Y5A_A        299 VQe--tIKKRIINMEIMEFYILPLIGSHIFPQTW--------------KNNRHSdrLKHFQTLLFDKIEIRYIKni---- 358  Kluyveromyces...
XP_002493917  308 C-----RSTVDSKLVKCNNYFIAIFGFHFLPQRWnd----------sqNMKFTDvsWKNIENDYRKSIATLDIHrpa-hv 371  Komagataella ...
Q6FU90        313 SQd--lKGTKIVNREIIELYFLAIFGSYFAPDVWtnp--------kkpGFLRNGlaVKTLELTLYEKIASRYIKni---- 378  [Candida] gla...
EDO14661      301 NKd--iLSTRIVDKEITEYYFLALFSNKFTKCIQkdipq-----ntddTLLDGRlkLNHIELALYERISTKYMKni---- 369  Vanderwaltozy...
CAR26928      305 LQe--mEGTKIINREIIEFYFLALFGAHFAPNAWlnpn------dkrcLLDGMG--TDHLKEVMLHRIRTRYLKnv---- 370  Zygosaccharom...
XP_002554554  299 KQe---RDGRVVNREIIEIYFLVLFCANFAPALWsge---------tgKCLLSGarLQHIREQYCQKTATRYAKnl---- 362  Lachancea the...
EDK40214      330 -------WQGGDLHLTSQIVLLNLIGYHYFPQRYrhgel-----lygnETYDNVe-REYLSFEFSQSHFQQLMStsseyi 396  Meyerozyma gu...
Q6BIA6        328 K-----NKISVSKIDELNITLICLICYYYVPEYYhqsnntitknfkhsKIEGDF--FKKLFESFDKYIRRYEEEdl---- 396  Debaryomyces ...
EER30368      303 ------SERRFSNANVMNVFLVCLLGYIYCPERYkn----------gpNIVKKIp-FSKIETDLFKMISSDFDEq----- 360  Candida tropi...
ABN64722      327 GRsktePTMEDDLNTMLACRVLYLYDPEEHQVDYktikk-----ttfsKLEDTL--SRHLKSSFSKLLSEGKDgs----- 394  Scheffersomyc...
5Y5A_A        359 sMIFQDLILLIGSFHmyqMINGVSsnirsi-----------qsetkFLEFIFKFFTHLIDKVIMKEFK-NCEMFQYLAMA 426  Kluyveromyces...
XP_002493917  372 kILWKQAIILISGYTilsNAKFNHewidrs----------enlleaYLQFVFHFIDEILTICTSGYSI----NTGLLPLV 437  Komagataella ...
Q6FU90        379 eTIYNDLIIGIGGFN---LLQLFGnmgpdsrvkilksntltrnqlsYLSFVFTYITRIITDVIKEAWNgNHEVYLYLAML 455  [Candida] gla...
EDO14661      370 hTIFVSLLTVIGGYEiisLNNTNSndqlrikkis--ldeisekqlaYLKFAFDLISHIFNNVIAKGWEnNLEKYEYLAMV 447  Vanderwaltozy...
CAR26928      371 eTIFHSLVTVIGGFDlllIIRNGPkktpfdiksin-lkdldetclsYLKFAFDFITQVFNTVIKDCWQkNLENYQYLAMV 449  Zygosaccharom...
XP_002554554  363 pLILQNEILLIAGFD---LLKTYNsankdeka-------tqkvknsFLGFSFDLISHFIDNVVVKEIE-NQQEWVYLAFV 431  Lachancea the...
EDK40214      397 nHYVHSLSLLIMFSE---LLNENNnq-------------------kLFRLTKLYISGFLALVESIDLK-TEGFEGSLVFL 453  Meyerozyma gu...
Q6BIA6        397 nLYVKQLVVLMSFNK---LLERGSdkli---------------seqFIKFTFRYINKLLESCVSMEFD-YQNKRVVLIIL 457  Debaryomyces ...
EER30368      361 -VVLKHLVVMFGIVR---LTREDEqr------------------dkLLRFAFRYVEKVLVYLKTGDGL--MVLRFILNLL 416  Candida tropi...
ABN64722      395 nFFLNQLVFLISI---------------------------------YYLFTYRYIDQFCTHLLDVELN-EISATNSLQCF 440  Scheffersomyc...
5Y5A_A        427 RIMMCWIKSHKNVLKFAHRSTSfcqSMVNLTNELLSs-------------nDLSISFEHLHRPTRDYFYEEDIMLKEFGP 493  Kluyveromyces...
XP_002493917  438 RLFLCWANQGGLPLNYLLANSStfdNLVHICEVASL---------------LVNKDELCISKPQRQYYFYEDVDLKEFVP 502  Komagataella ...
Q6FU90        456 RIIGCWIFANESVLEFAKSNVAfcqAYADLLNDFLAs-------------gLVSYGPDNSVKPKRSYLFEEDIQLRELGF 522  [Candida] gla...
EDO14661      448 RIVICWIKSNKSVIQYSHRNRKfcdSFVNLLNNFLSs-------------kKFTEMTIPDVRPGRAYFFQEDIFLKEFSP 514  Vanderwaltozy...
CAR26928      450 RIVECWIKSNRAVLQFSHRDEGfckSLLQLLNDIGKs-------------kLVKVSPTANHRPKRKYFFPEDVDFKEFSC 516  Zygosaccharom...
XP_002554554  432 RVVNCWLMSNKAALQFAHRDVRfcdAMMRLMNSVLKs-------------pTLTRPPELNHRPRRPYFFEEDVSLRDFKS 498  Lachancea the...
EDK40214      454 RLALAYIKENKPFAKYFFRDAAmvvSLCSPFNEILSkc------------dWIHESVRTNSKPTRSYYYTEDVVFKDFSP 521  Meyerozyma gu...
Q6BIA6        458 RLLSNWFKENKVILRNFQARKSlmvNIVTLLNGMTSdiygndslsqdinreKIIHLIKSNSRPVRDYYFKEDVYFRDFLI 537  Debaryomyces ...
EER30368      417 RENAPWLQVFT-------SRRNcvvYLTAVLKRFAS---------------------DSTTRPTRMFFFEEDVNFRDCSL 468  Candida tropi...
ABN64722      441 RLILNWIKENKRAYRSLQDKHRtmsKIVQVSNKFLE-----------------DNSLNIPDKV---HYFQEDLMFKDFIV 500  Scheffersomyc...
5Y5A_A        494 TKFTL 498  Kluyveromyces lactis NRRL Y-1140
XP_002493917  503 IGCRF 507  Komagataella phaffii GS115
Q6FU90        523 IGDEL 527  [Candida] glabrata
EDO14661      515 IKYAL 519  Vanderwaltozyma polyspora DSM 70294
CAR26928      517 VKYAL 521  Zygosaccharomyces rouxii
XP_002554554  499 VKFTL 503  Lachancea thermotolerans CBS 6340
EDK40214      522 IKYQF 526  Meyerozyma guilliermondii ATCC 6260
Q6BIA6        538 IKFQL 542  Debaryomyces hansenii
EER30368      469 IKYQF 473  Candida tropicalis MYA-3404
ABN64722      501 IRNQF 505  Scheffersomyces stipitis CBS 6054
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap