2FB5


Conserved Protein Domain Family
YojJ

?
pfam10372: YojJ 
Bacterial membrane-spanning protein N-terminus
YojJ is the N-terminus of a family of bacterial proteins some of which are associated with DUF147 pfam02457 towards the C-terminus. It is a putative membrane-spanning protein.
Statistics
?
PSSM-Id: 402131
View PSSM: pfam10372
Aligned: 9 rows
Threshold Bit Score: 92.7706
Threshold Setting Gi: 328765724
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FB5_A                  10 LSEELKIQTKQMIEIAEKELSIMRNAIDKEDECILCKMEDIHHMLANVQTLAATYYIQAYLSPY 73 
EGF75861                 7 LTEPIKSQIKNNLRQVTVEIEDMLRQMDSSDCRILSEFEHVHDVFSDLQRTTASHYLNAYLSPF 70  Batrachochytrium dend...
WP_013121506             6 LQTNIREDLRKKLEEIRQRVEEVMKIMNGQQGCMLCEIKSIRESAGKLEGLISYYHFQSSLMPY 69  Thermincola potens
BAH43638                 7 DTSSLKEELLQELRGISVTLDESIHALKNENECVLGTFDQIRTKFSRLETVAASFYLQCYLSPY 70  Brevibacillus brevis ...
WP_015735928             7 NFTPLKRKLKEQLSDITGHLQQVIVNLDQDGSCLLGELDSIRTKFMEAESISSTYYLNCFLFPF 70  unclassified Paenibac...
PRJNA212797:N288_15565   4 SEKHYRSDLARYFRDIEGQLGTVETTMKELDCCILTEFEKLQKLVADAQNLASTYYLQTFLSPF 67  Bacillus infantis NRR...
O31854                  10 SENAFKGKIQVYLEQILGDASLILKTLHEKDQCLLCELDDLGHVFQDMQGIASSFYLQSYIEEF 73  Bacillus subtilis sub...
ABV62537                 7 EEAQFKVGMRTHLMKIMKDASDIIDSLDEIEQCLLCDLESLHDEFNEMHAEASSFYLQSYMEEY 70  Bacillus pumilus SAFR...
Q81XS6                   6 LSEELKIQTKQMIEIAEKELSIMRQAIDKEDECILCKMEDIHHMLANVQTLAATYYIQAYLSPY 69  Bacillus anthracis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap