Conserved Protein Domain Family
DUF2430

?
pfam10353: DUF2430 
Protein of unknown function (DUF2430)
This is a family of short, 111 residue, proteins found in S. pombe. The function is not known.
Statistics
?
PSSM-Id: 118874
View PSSM: pfam10353
Aligned: 2 rows
Threshold Bit Score: 191.321
Threshold Setting Gi: 50401799
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9URW1   1 MLLLLYICCLFLKFILANVDLTFVEYAKLPSKYAELLANATNQQGVMLFSTGDIRIGAYNYLVNNVTEINNDTDAYLCQL 80  Schizosaccharomyces p...
Q9HDT7   1 MLLLFCICCVFIKLVLAEVNLTFVDYAKLPPNYAELLANLIDQHGLMLFDTADVRIEAYNYLLNSITETNTDTDAYLCQL 80  Schizosaccharomyces p...
Q9URW1  81 LTGQYTTDCYIFDTNSDDKPETFNSSI 107 Schizosaccharomyces pombe 972h-
Q9HDT7  81 LTGQYTTDCYIFGDSVYEGPENINPST 107 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap