Conserved Protein Domain Family
Apt1

?
pfam10351: Apt1 
Golgi-body localization protein domain
This is the C-terminus of a family of proteins conserved from plants to humans. The plant members are localized to the Golgi proteins and appear to regulate membrane trafficking, as they are required for rapid vesicle accumulation at the tip of the pollen tube. The C-terminus probably contains the Golgi localization signal and it is well-conserved.
Statistics
?
PSSM-Id: 402116
View PSSM: pfam10351
Aligned: 145 rows
Threshold Bit Score: 212.888
Threshold Setting Gi: 145347745
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFX02199     2258 VVQKTSATLRYDKYNTLRLKYNegvsagegataatsatatatssgdntELRMDNLWVEFPQVRALCNSSQYYAIYVIVLD 2337 Grosmannia cl...
ERN14359     1967 VFMPCTMYFRYTRHKGGTADLK--------------------------MKPLKELAFNSPNITATMTSRQFQVMLDILSN 2020 Amborella tri...
XP_010664427 1933 VFMPCDMYFRYTRHKGGTADLK--------------------------VKPLKELTFNSRNITATMTSRQFQVMLDVLTN 1986 wine grape
XP_019066825 1933 VFMPCDMYFRYTRHKSGTTQLK--------------------------VKPLKELSFNSHNITAAMTSRQFQVMIDVLTN 1986 tomato
XP_002888245 1912 VFMPCDMYFRYTRHKGGTPDLK--------------------------VKPLKELTFNSHNIIATMTSRQFQVMLDVLTN 1965 Arabidopsis l...
XP_009113328 1917 VFMPCDMFLRYTRHKGGNPDLK--------------------------VKPLKELTFNSHDITATMTSRQFQVMLDVLTN 1970 field mustard
XP_002301119 1936 VFMPCDMYFRYTRHKGGTPDLK--------------------------VKPLKELTFNSHNIMATMTSRQFQVMLDVLTN 1989 black cottonwood
XP_015630633 1914 VFMPCEMYFRYTRHKGGTADLK--------------------------VKPLKELIFNSPNITATMTSRQFQVMLDVLTN 1967 Japanese rice
XP_012698131 1898 VFMPCQMYFRYTRHKGGTADLR--------------------------VKPLKELCFNSPDITATMTSRQFQVMFDVLRN 1951 foxtail millet
Q6IMT0       1917 VFMPCDMYFQYTRHKGVTPDLK--------------------------VKPLKELTFNSRNITASMTSRQFQVMTDVLSN 1970 thale cress
EFX02199     2338 LLMYSEPLEK------------TRSERLEKIM---LA-SDFSD--LRGAPEVVIRLQERVRQL------ED-IKTHFQIH 2392 Grosmannia cl...
ERN14359     2021 LLFARLPKPRksslsypadedeDVEEEADEVVpegVEeVELARinLEQAEREQKLILDDIRTLavpsdtSGeISSILEKY 2100 Amborella tri...
XP_010664427 1987 LLFARLPKPRksslsypveddeDVEEEADEVVpdgVEeVELARinLEQKEREQKLLLEDIRKLslcsdtSGd--LCPEKE 2064 wine grape
XP_019066825 1987 LLLARAPKPPkvslsysegddeYEEEEADEVVpdgVEeVELARvdLEHKARAQKLIQEDIKKLslctdaSAd--MGPAKG 2064 tomato
XP_002888245 1966 LLFARLPKPRksslqc-ptedeDVEEEADEVVpygVEeVELAKinLEEKERGRKLLLDDIRKLspcsdnMDd--THIERE 2042 Arabidopsis l...
XP_009113328 1971 LLFARLPKPRksslqc-ptedeDVEEEADEVVpygVEeVELAKinLEEKERARKLLLDDIRKLsycsdnIDd--THMERE 2047 field mustard
XP_002301119 1990 LLFARLPKPRksslsypaeddgDVEEEADEVVpdgVEeVELAKinLEQKEREHKLILNDIRKLslfsdtSGd--PLSRKE 2067 black cottonwood
XP_015630633 1968 LLFARLPKPRknslqy-ssddeDVEEEADEVVpdgVEeVELAKisLEQKERERKLLLDDIRSLmgtgnnHTsNFLSVERD 2046 Japanese rice
XP_012698131 1952 LLLATLPKPRknslqy-psddeDIEEEADEVVpdgVEeVELAKinLEQRVREMKLLLDDRRSLtgngdsGTdHCYSAEKD 2030 foxtail millet
Q6IMT0       1971 LLFARLPKAHndslklsgeeddEVEEEIDEVVpdgIEeVELAKieLEAKERDRMMLLDDIRKLtqnesnSGn--INLEKE 2048 thale cress
EFX02199     2393 SK-YLDRRGW-EERLLLERDLAACE-------DELFFIMQAItrSQ-ARNEaneaaaaaaaaaaaaaeagsesssiSGSN 2462 Grosmannia cl...
ERN14359     2101 GDlWMITSGKsVLVQCLKKELGDKQmarkaasVSLRLALQKA--AHlRLMEk------------------------EKNK 2154 Amborella tri...
XP_010664427 2065 GDlWMTTEGRsTLVQRLKKELGNAQkarkaasASLRMALQNA--AQlRLMEk------------------------EKNK 2118 wine grape
XP_019066825 2065 GDlWIISGGRsILVQKLKKDLINAKkirkvssASLRMALQKA--AQqRLMEk------------------------EKNK 2118 tomato
XP_002888245 2043 GElWMISTRRsILVQGLKKELTYAQksrkaasASLRMALQKA--AQlRIMEk------------------------EKNK 2096 Arabidopsis l...
XP_009113328 2048 GElWMISTRRsILVQGLKKELLYAQksrkaasVSLRMALQKA--AQlRLMEk------------------------EKNK 2101 field mustard
XP_002301119 2068 ADlWMVTGGRySLVQGLKRELVSAKksrkeasVSLRMALQKA--AQlRLMEk------------------------EKNK 2121 black cottonwood
XP_015630633 2047 DClWMINSGKsLLVERLKRDLENLKksrksasSTLRKALQKA--AQlRLMEk------------------------EKNK 2100 Japanese rice
XP_012698131 2031 DHlWMINSGKtSLVAKLERDFKSLEtsrksasSALREALQKA--AQsHLNEk------------------------EKNK 2084 foxtail millet
Q6IMT0       2049 SDfWMISGGRpVLVERLRKAYLSVQqsrktayTALRTSVKNA--AElRLLEk------------------------DKNK 2102 thale cress
EFX02199     2463 AL---LKWSISAREIVWHLVRNShEPLVELQLKDVEYDRTDNADGSHINLIQVGRILGLNLLPDATYPEMVAPYfdargp 2539 Grosmannia cl...
ERN14359     2155 SPsyaMRISLRINKVVWSMLADG-KSFAEAEINNMNYDFDRDYKDIGVAQFTTKSFVVRNCMPNVKSDMLLSAWnpp--- 2230 Amborella tri...
XP_010664427 2119 GPsyaMRISLQINKVVWGMLVDG-KSFAEAEISDMFYDFDRDYKDVGIAQFTTKYFVVRNCLPNVKSDMLLSAWnpp--- 2194 wine grape
XP_019066825 2119 SPscaMRISLQINKVAWSMLVDG-KSFGEAEINDMIYDFDRDYKDIGIVKFTIKSFAVRNCLPNAKSDNLLSAWnpp--- 2194 tomato
XP_002888245 2097 SPsyaMCISLQINKVVWSMLVDG-KSFAEAEINDMIYDFDRDYKDIGVARFTTKYFVVRNCLQNAKSDMLLSAWnpp--- 2172 Arabidopsis l...
XP_009113328 2102 SPsyaMCISLQINKVVWSMLVDG-KSFAEAEINDLIYDFDRDYKDIGVARFTTKSFVLRNCLPHAKSDMLLSAWnpp--- 2177 field mustard
XP_002301119 2122 SPsyaMRISLKINKVVWSMLVDG-KTFAEAEINDMIFDFDRDYKDVGVALFTTKYFVVRNCLSNAKCDMVLSPWnap--- 2197 black cottonwood
XP_015630633 2101 TPscaKRISMKISKVVWSMIADG-NTFAEAEISEMVFDFDRDYKDIGVGRFTTKCFEVRNCISNAKCATLLSAWntp--- 2176 Japanese rice
XP_012698131 2085 TPsfaMRISMKISKVVWSMLADG-NTFAEAEINDMVCDFDRDYKDIGVARFTTKYFVVRNCMANAKCDTLLSAWntp--- 2160 foxtail millet
Q6IMT0       2103 RPssaMRISLQINKVIWSMVLDG-KTFAEVEIDNMIYDFNRDYRDIGIAQFTTRYVVLRNCLPNAKCDTVLSAWnpp--- 2178 thale cress
EFX02199     2540 gprdMDTQPMVSVYWYMLEAIAGITVM---DHFEVTLFPMRIQLEHEVGKKLFEYIFPDSDGDAINKdg-------taTa 2609 Grosmannia cl...
ERN14359     2231 --peWGRNVMLRVDAKQGAPKDGSSPL---ELFQVEIYPLKIHLTETMYRMMWDYFFPEEEQDSQRRqevwkvsttagSr 2305 Amborella tri...
XP_010664427 2195 --peWGKKVMLRVDAQQGAPKDGHSPL---ELFQVEIYPLKIHLTETMYRMMWEYLFPEEEQDSQRRqevwkvsttagSk 2269 wine grape
XP_019066825 2195 --peWGKKVMVRVDAKQGAPKEGSSTI---ELLQVDIYPLKIHLTESMYSMMWAYFFPEEEQDSHRRqevwkvsttagAk 2269 tomato
XP_002888245 2173 --peWGKKVMLRVDAKQGAPKDGHYPL---ELFHVEIYPLRIHLTETMYRMMWEYFFPEEEQDSQSRqevwkisttagSk 2247 Arabidopsis l...
XP_009113328 2178 --teWGRKFMLRVDAKQGAPKDGHYPL---ERFHVEIYPLRIHLTETMYRMMWEYFFPEEEQDSQMRqevwkisttagSk 2252 field mustard
XP_002301119 2198 --tdWGKEVMLRVDAKQGAPRDGNSRI---ELFQVKIFPLKIYLTETMYKMMWEYFFPEEEQDSQRRqevwkvsttagAk 2272 black cottonwood
XP_015630633 2177 ----peKGVMLRVDLRQGAPKDGNSPVdlfELFQVEIHPLKIYLSETMYRMMWDYFFP-EEDDSQRRqevwrvststgAr 2251 Japanese rice
XP_012698131 2161 ----pgKINMLRVDAKQGAPKDGNSLL---ELFQVEIYPLRIYLSEAMYRMMWDYFFP-EEDDSQRRqevwrvststgPr 2232 foxtail millet
Q6IMT0       2179 --peWGKKVMLQVDARQGAPKDGQAPY---ELFQVEIYPLKIHLTETMYTMMWEYIFPGEEQHSQRReevwkvsttsgSr 2253 thale cress
EFX02199     2610 ndgptVED---------DEDDNEDDESIFA-----------TDETTAAAAAALDGDRAGSLEMRlhptltsnqrtttsps 2669 Grosmannia cl...
ERN14359     2306 -----RGKknislsaesVASSSRSVRESEVpikhgmsatpsMATGLSQSSHGDVSQGSKLQNLK---------------- 2364 Amborella tri...
XP_010664427 2270 -----RVKkgas-iheaS-SSSHSTKESEMptkssssilpfTFPPSQSSVPPDSAQVSKLQNLK---------------- 2326 wine grape
XP_019066825 2270 -----RAKkgss-aqeaPVSSSHLTKDSQSss------------------ngDLSQATK--NPK---------------- 2307 tomato
XP_002888245 2248 -----RVKkglv-ghesSGHAIKDVEAARMsssa-----lsasAAVQSQSNADSVQKSNILCLR---------------- 2300 Arabidopsis l...
XP_009113328 2253 -----RVKkgla--gdsSTTSHSAVEASRRsses-----lsasATTLSQSNADSVQKSNTPSLR---------------- 2304 field mustard
XP_002301119 2273 -----RVKkgps-sheaSSSCSHTTKESDVps------------------------------------------------ 2298 black cottonwood
XP_015630633 2252 -----RARrist-gadaVASTSYSVREHELpgrsginvstsTNVSSWQGS--DNSQVSKLQSLK---------------- 2307 Japanese rice
XP_012698131 2233 -----RTRrlss-gvdaVSSSSYSVKEHELpgksgaivsmsTSVSSWQGLHGDNSQVSKLHTIK---------------- 2290 foxtail millet
Q6IMT0       2254 -------RrkgsfaqeaAALLAAS----------------------------DLGQGSKNQSLK---------------- 2282 thale cress
EFX02199     2670 aspstilgdgssskhktpsvhsgdsgshpfrffrtPNTGST------TRSLARRPSHE--SLQSLQSIQslqsaqsmrtg 2741 Grosmannia cl...
ERN14359     2365 -----------------------------------ANMVCGtnselrRTSSF-DKNWEenVAESVAVELvlqvhsasvsn 2408 Amborella tri...
XP_010664427 2327 -----------------------------------ANIVCGstpelrRSSSF-DRTWEenVAESVANELvlqahssnfps 2370 wine grape
XP_019066825 2308 -----------------------------------AN-ASAvtpnlrRTSSF-DKNWEenVAESVANELvlqmhsssvss 2350 tomato
XP_002888245 2301 -----------------------------------TS-TGGsapelrRTSSF-DR--EenVAEPVANELvlqahsctvss 2341 Arabidopsis l...
XP_009113328 2305 -----------------------------------CS-TGGsaq-elRTSSF-DRTGGenMAESIGNELvlhassveqqe 2346 field mustard
XP_002301119 2299 ------------------------------------kVIGSsapelrRTSSF-DRTWEetVAESVATELvlqahssgiss 2341 black cottonwood
XP_015630633 2308 -----------------------------------SNVVCGshpelrRTSSF-EMTLEesAVDSITNNNvvslvnsnvss 2351 Japanese rice
XP_012698131 2291 -----------------------------------ANMVCGshqelrRSSSFDERPWDesAAESVTSNDvvslmnsstvs 2335 foxtail millet
Q6IMT0       2283 -----------------------------------SSTIRGsgrelrRTSSF-DRSWEetVAESVATELvlssmehqges 2326 thale cress
EFX02199     2742 tginrsatglsslmdgstvtansgsssrfglrrknsegtkpemgstnitntsasatatasananassssniirqtvlggh 2821 Grosmannia cl...
ERN14359     2409 tkseslnsssehqyag-----------------------------------------yedtsksrskdpkptlksgrfsh 2447 Amborella tri...
XP_010664427 2371 sksgplgfieqqd-----------------------------------------------dpsrnklkdskpiksgrssh 2403 wine grape
XP_019066825 2351 sksgslaniehpd------------------------------------------------esnknkskesksiksgrsn 2382 tomato
XP_002888245 2342 sveqqedssk------------------------------------------------------qkvkeikpvksgrssh 2367 Arabidopsis l...
XP_009113328 2347 dsskqkp------------------------------------------------------------ketktikpgrssh 2366 field mustard
XP_002301119 2342 sksepfdsieqpd-----------------------------------------------essrskskeskpvksgrssh 2374 black cottonwood
XP_015630633 2352 rdtnnfmadnsvaa---------------------------------------------aemfrsrtkdskptksvrlsq 2386 Japanese rice
XP_012698131 2336 skgdannpvsenpvv-------------------------------------------gtdlwrsktkdskpaksgrlsh 2372 foxtail millet
Q6IMT0       2327 skgklk-------------------------------------------------------------dsktskaggrsvh 2345 thale cress
EFX02199     2822 gnnhTSDDLTKMIARASNYMTFAHVRMPSVVLCLSYKGRGDrnleDVHDFVFRLPTIEYRNKTWSNLDLALELKSRVIKA 2901 Grosmannia cl...
ERN14359     2448 eekkVGKLQDEKRSKGRKTMEFHNIKISQVELLVTYEGSRF----AVNDLRLLMDTFTRVDFTGTWRRLFSRVKKHIIWG 2523 Amborella tri...
XP_010664427 2404 eekkVGKSNDDKRSRPRKMMEFHNIKISQVELLVTYEGSRF----AVSDLKLLMDTFHRVEFTGTWRRLFSRVKKHIIWG 2479 wine grape
XP_019066825 2383 eekkVGKAHDEKKSRPRRLREFHNIKISQVELQITYEGSRF----AVGDMRLLMDTFHRVEFTGTWQRLFSRVRKHIIWG 2458 tomato
XP_002888245 2368 eekkAGKSHEEKKSRPRKMMEFHNIKISQVELLVTYEGSRF----VVNDLKLLMDTFHRVEFTGTWRRLFSRVKKHIIWG 2443 Arabidopsis l...
XP_009113328 2367 eekkAGKSHEEKKSRPRRMMEFHDIRISQVELLVTYEGSRF----VVNDLKLLMDTFHREEFTGTWRRLFSRVKKHIIWG 2442 field mustard
XP_002301119 2375 eekkVGKTNEEKRSRPRKVMEFNNIKISQVELQLTYESSRF----NLHELKLLMDTFHRVEFTGTWRRLFSRVKKHVVWG 2450 black cottonwood
XP_015630633 2387 dekkVGKSHDEKRTRARKLIEFHDIKISQVELIVTYEGSRL----AISDLRLLMDTFHREDFTGTWRRLFSRVKKHIIWS 2462 Japanese rice
XP_012698131 2373 eekkVGKSNEEKKTRARKTIEFRNIKISQVELLVTYEGSRL----AINDLRLLMDTFHKPEFTGTWRRLFSRVKKHIIWG 2448 foxtail millet
Q6IMT0       2346 eekkGEKSLEDKKSRPQKIMQFQTIKISQVELLITYEGSRF----VVNDMKLCMDTFHRVEFSGTWRRLFSRVKKHIIWG 2421 thale cress
EFX02199     2902 LISHT 2906 Grosmannia clavigera kw1407
ERN14359     2524 VLKSV 2528 Amborella trichopoda
XP_010664427 2480 VLKSV 2484 wine grape
XP_019066825 2459 VLKSV 2463 tomato
XP_002888245 2444 VLKSV 2448 Arabidopsis lyrata subsp. lyrata
XP_009113328 2443 VLKSV 2447 field mustard
XP_002301119 2451 TLKSV 2455 black cottonwood
XP_015630633 2463 VLKSM 2467 Japanese rice
XP_012698131 2449 VLKSV 2453 foxtail millet
Q6IMT0       2422 VLKSV 2426 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap