Conserved Protein Domain Family
Vel1p

?
pfam10339: Vel1p 
Yeast-specific zinc responsive
This is a small family of proteins from Saccharomyces and related species. The function is not known but member proteins are highly induced in zinc-depleted conditions and have increased expression in NAP1-deletion mutants. The S. cerevisiae genes are named VEL by association with Velum formation in the wine making process http://www.ajevonline.org/content/48/1/55.abstract
Statistics
?
PSSM-Id: 402107
View PSSM: pfam10339
Aligned: 4 rows
Threshold Bit Score: 349.934
Threshold Setting Gi: 359746420
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002554219          9 FVTGILSTs-VAAFRYDWSNITCKGLHGPHCGTYLLKVKNQNDTYLGQSYFVGADALANDATDAWGRLLHEEYRFIPRLT 87  Lachance...
CCE89552              9 FISLTFSV--AAAVRFDLTNVTCTDLHGVHCGTYALKVADVDGAFLGQKTFVGADVLATGAEDAWGRFLSQETRFLPRLT 86  Torulasp...
P0CU12               10 FIGL------ATAIRFNLTDLECSRLRGPHCGTYLLKVVGTNATYVGEKSFIGLDALTESKGEFFQRMLEQEPRLIPRLF 83  Schizosa...
WGS:AATM:SJAG_00161  10 FIQTFVVLngVSALRFDLTNVTCSRLRGPRCGTYLLRVAGTNATFLGQKYLVGFEALTQPKEDFLKRYLENEPRLIPRLT 89  Schizosa...
XP_002554219         88 TVQTlNDTGNFRPFVGTTDMSTCNFQSVENAVVPYINTVTNELSYDSWASISMNATAVTGVAPQLLKASTYGIQVAICNP 167 Lachance...
CCE89552             87 TVGT-NETKNFSPFYFTTNHETCNPQSIEDSMIPFVNTITNEIQFDAWAYTAMNVSVPTGLANQLFNATDYGVQVAQCYN 165 Torulasp...
P0CU12               84 TIAE-NDTANFTPLTFTTYLKTCNPQSIENAMIPFVNTVTSEISFDAWAYTAQNSSRITGLSNQLMNSTLYNVQVATCTP 162 Schizosa...
WGS:AATM:SJAG_00161  90 TVAE-NQTDSFHPFFFTTNQASCNPQSIESDLIPFVNTVTNEIQYDSWAYTMLNASLINGLANQLMNASTYGVQVATCLP 168 Schizosa...
XP_002554219        168 GFITDLFQSPTVNLFNVEDTLPSWCEAIEVEAVCPA 203 Lachancea thermotolerans CBS 6340
CCE89552            166 GIASELLDAPTVNIFDKDEVLPSYCSPIKLEAVCPI 201 Torulaspora delbrueckii
P0CU12              163 GFSALLLDSPTINVFNNEEGMPSWCQPIELTPVCPL 198 Schizosaccharomyces pombe 972h-
WGS:AATM:SJAG_00161 169 GFTNGYFDAPTVNIFNNDEEVPSWCTAIEFEAVCPL 204 Schizosaccharomyces japonicus yFS275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap