Conserved Protein Domain Family
DUF2418

?
pfam10332: DUF2418 
Protein of unknown function (DUF2418)
This is a conserved 100 residue central region of a family of proteins found in fungi. It carries a characteristic EYD sequence motif. The function is not known.
Statistics
?
PSSM-Id: 402103
View PSSM: pfam10332
Aligned: 88 rows
Threshold Bit Score: 85.2574
Threshold Setting Gi: 281207190
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAZ82798     180 RDVWEVSVWDPTPLSLRLFAIFSPVHVLIYFLVLpitsnatlsssgfvkfptppTTNTVGTILmmlaTQFILSVQLIHTQ 259 Perigord truffle
XP_007372933 192 EDTYYMNTWDPNKFTLHLFITLNPLNIFIIHI------------------------SSLLISL----AVMVIQVTMSWLI 243 Spathaspora pas...
ABN65846     198 DEIWQLNVWDPSKFSLYVFMTLNPVNLLLIHNLTsi----------------asTSSMLFGIG----SIASISATFYFVI 257 Scheffersomyces...
XP_002545533 206 NEVWHLNVWNPSKFALYLFIGLNPINIYLVYYLMs-------------------DVSHLYLLF----LLVIVSGVNYFLI 262 Candida tropica...
CCE44575     198 gESWQLRVWQPSKFSLYLYVGLNPINSFIIGNFTl-------------------QFSSLSIIG----LILVVSVSNYKLI 254 Candida parapsi...
XP_001524566 216 KEYWELHVWNPSKFCLYIYVGLNPINAFLVYTLTs-------------------KGSTLNAIT----SLALISVFNYLFI 272 Lodderomyces el...
XP_004201199 206 KEVWELCVWDPPKFSLYLFTTFCPATLIIDRLTSn-------------------SIAFWKSLL----LITLFNAILYYVI 262 Pichia farinosa...
EGV62987     204 kLVYEIDVWQPSQFCLILFSFVNPIGLLVAKIMV--------------------EMSVWKVGL----TVLLFNFQMYYLI 259 Yamadazyma tenu...
Q6BHP4       206 KDIWELKVWNPSKFSLFVLTNFSPILLFIIKLVSk-------------------ELPVWKILF----IALIFNGNFYFII 262 Debaryomyces ha...
XP_001483802 206 KDVWQLQVWDPSRFSMMLSATFSPPLMILIYIGGg-------------------PLPFYTLII----SYLAFAGLSYLTI 262 Meyerozyma guil...
CAZ82798     260 -MSFAQQAKDTTLIHKEVLHEYDQKFVHPRLNVLKRDVAVQ 299 Perigord truffle
XP_007372933 244 iSKFNQLIIDKQIIYQEMFKEYNNKFVNPKLNILKKDVAID 284 Spathaspora passalidarum NRRL Y-27907
ABN65846     258 -SRFLDLINDKQILYQEMFQEYNNKFVKPKTNILKKDLMID 297 Scheffersomyces stipitis CBS 6054
XP_002545533 263 -EKFLNLVSDKQILYQEMFQEYNKKFVQPKINVLKKDAMVD 302 Candida tropicalis MYA-3404
CCE44575     255 -DCFLGLIQDKQIIYQETFSEFNNKFVKPKTNILKKDAMVD 294 Candida parapsilosis
XP_001524566 273 -SKFLNLVQDKQIVYQEMFLEYNNKFVKPKVNILKKDASID 312 Lodderomyces elongisporus NRRL YB-4239
XP_004201199 263 aNKFLTLLQDKQILYQEMFQEYNNKFVKPKTSVLKKDVLVD 303 Pichia farinosa CBS 7064
EGV62987     260 -NKFLVLINDKQILYQEMFQEYNDKFVKPKTNVLKQDVGID 299 Yamadazyma tenuis ATCC 10573
Q6BHP4       263 tQRFLVLLQDKQILYQEMFQEYNNKFVKPKTSVLKKDVVVD 303 Debaryomyces hansenii
XP_001483802 263 -QKFLLLVADKQILYQEMFQEYNKKFVLPKTSVLRKDAIID 302 Meyerozyma guilliermondii ATCC 6260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap