Conserved Protein Domain Family
7TM_GPCR_Str

?
pfam10326: 7TM_GPCR_Str 
Serpentine type 7TM GPCR chemoreceptor Str
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Str is a member of the Str superfamily of chemoreceptors. Almost a quarter (22.5%) of str and srj family genes and pseudogenes in C. elegans appear to have been newly formed by gene duplications since the species split. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 402099
View PSSM: pfam10326
Aligned: 160 rows
Threshold Bit Score: 243.132
Threshold Setting Gi: 75028921
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP30495       8 KVFVQWTSFLCSLVFNSILIFLIITKSPKKMGNYRWLMIYFSCFAIFFSTLDMIVGPFIHAHGTSACLL-MRRSEPED-V 85  Caenorhabditis ...
O76658         7 SDNASRVLYIATVVLNCFLIHLTVYHTKQINGAYRSMIVIFALMGLWFTSLDILVRPLMHSYNSCIMYFtL-GGTFRG-L 84  Caenorhabditis ...
O17716        21 AQLVAQIGFFTTTVFCGILIFLTVFGGQKNFGSYKNLLVLFSTVGIFFSVVELTLYPNVHSFYAGYFFYsT-QRPFGL-K 98  Caenorhabditis ...
XP_002637697  18 AQSVAEAGFCSTMVFCGILIFLTIFGVKRNFGSYKYLLILFPAVGIFFATVELILYPNVHSFNAGYFFYsT-RRPFGV-G 95  Caenorhabditis ...
O62017        12 THFIPKLGFVTTFMSGLCLLFLNYFGAQKNFGSYKYLISAFTMLGMIFATVEIIVYPNVHNYKASFLFYsF-EESFGLsG 90  Caenorhabditis ...
O17896        13 CIFMGDLGFFSNAFFGFILVYLTLFYIKRQFGSYKYLLVNFQLLGFIFASFEFLFHTFLHTYNASLIYFsL-SRPLGL-S 90  Caenorhabditis ...
O45809        10 TKLISKVGFLSTTILGMLFVCLTVCFVKRDFGSYRNLLIVFSFLGFLFSASEYMIHPMIHSYNSGFVFFtE-PHLSLV-S 87  Caenorhabditis ...
XP_002637694  10 TRFIAKVGFIFTSLLVLLFIFLTIYFVKRDFGSYRNLLIAFSILGFSFSSSEYIVHPMIHSYSAGFVFFtN-PQTSIV-S 87  Caenorhabditis ...
P91984        10 SLLASEIGFFSTLIVNSFLVHLIIFYTKQVFGAYKYLVLSFSLMGIVFATAEFIVKPMTHNYKASFTFFtL-ERPFKC-S 87  Caenorhabditis ...
NP_001309465  17 AQRVAQFGFFATTTSCTVLILLTIYGVKRDFGSYKNLLLMFAGLGIVFATTEVLLFPNLHSYNAGYFFY-SMERPFRL-D 94  Caenorhabditis ...
CAP30495      86 ANVQYVLLmklnqyftVLLCSCFGVTITFFAIHFVFRYFALERRGRI-AYFDGKYFLIWLAIPVVCGTVWGLALHFFVGH 164 Caenorhabditis ...
O76658        85 KRAAEASL--------LVYSAMYGILIAFLCIQFIYRACVLARPI-WsKIFDGWKLIYWLLYCLIIGGLWSYAT-FLCSS 154 Caenorhabditis ...
O17716        99 IEIVQVLM--------AFYTSIYASTICMLAVQFVYRYWAIFNESLL-HYFKGWRFLFSIAYSFIVGAQWGLSIYFFDEM 169 Caenorhabditis ...
XP_002637697  96 IEIVTILM--------AFYTSIYASTICMLSVQFVYRYWAIFDETKL-RFFKGWKFLFCVAYSVIVGAQWGLSMYFFNQM 166 Caenorhabditis ...
O62017        91 SWSRNIPL--------AGYTFFHSATMSLLSVHFIYRYWAVFDTNKL-AYFNGCYSLIWFFYCAFFGFQYSLGTYFFLAR 161 Caenorhabditis ...
O17896        91 NFSMEWMM--------GIYTGLYSATICQLAIQFIYRYWALFDTPKI-KYFHGWYYLIWVSYYSFFGVLWAFAVGHFFAM 161 Caenorhabditis ...
O45809        88 NEIMKIGL--------VFFCGIYGSTICFISVQFLYRYWALFDAPKL-IWFEGWMMSAWLIYSFGIGATWSIGIHYFLEN 158 Caenorhabditis ...
XP_002637694  88 NDVMKIGL--------VFFCGIYGSTVCFIAVQFMYRYWALFDAPKI-KWFESWRILLWCCYSLSIGILWAGGIHWFLEI 158 Caenorhabditis ...
P91984        88 KETAMILL--------AAYSSTYAATISLLAVQFVYRYWAIFHVRRL-SFFNGIWILFWIFLAMMFGVDWSCSVYFLGMP 158 Caenorhabditis ...
NP_001309465  95 TKNVSRFL--------VIYTGLYGSTICLLSVQFVYRYWAVFSESKL-KFFKGWRFIFCIMYCAAFGADWGLSIYYFDEM 165 Caenorhabditis ...
CAP30495     165 TDETTEYLRENILYHYNLKMKDVIYVGAFYWrtLENG--KteLVISTAIAAVIMFSIKATSISVVCYYGFLSYRRI-SEL 241 Caenorhabditis ...
O76658       155 DTMTNRYMRNEIRSNYGVDIRNVAYFALMGYn-YNGTekT--LRWNSVSTFSMFVVILLTQYVICLVCGFIMYRRIeGNA 231 Caenorhabditis ...
O17716       170 DDYTDNYMRNEMWERYDINISQVAKMALVAY--NDDG--S--IRWWNVCCIIDMTVFMIVQYSIVIYCAVVMYQKMeEKL 243 Caenorhabditis ...
XP_002637697 167 DDYTDHYMREELLYRYDLTITEIARLCLVSY--NEDG--S--LRWRNNSSTIDMTIFMIVQYTIVIYCAIVMYQKMeEKL 240 Caenorhabditis ...
O62017       162 DEITDEYLREDMLLRYNANISELPAMAIVAYd-PVDG--S--VRWRNVMGIFNICSIVNFQYAIMFYCGWSMHTKMeDKI 236 Caenorhabditis ...
O17896       162 DDFGREYLGGEILLRYERNITDIPVLGLIAY---EGN--S--IRWRNVYGLSLMTLISTIQYSVILICGHQMYHGMrAKL 234 Caenorhabditis ...
O45809       159 DNFTLNYFENGVYDHYGWKLSAIPSFTFVIY--TERG--A--IRWRNLACTIEMTMIIGLQYSIICFCGRKMSVGMkEKI 232 Caenorhabditis ...
XP_002637694 159 DDFSIDYFQQGVRQIYGLELSSIPGFTSVIY--TRKG--D--VRWRNLMCTIEMTMIIGMQYMIICFCGRKMSTGMkEKI 232 Caenorhabditis ...
P91984       159 DKVSEDYLRLEISDQYNLNITRLAYFSAVVY--DSEY--H--IRWRSVMVMGSVSKVLSIQYAVMIFCGVRMHFKMaEKM 232 Caenorhabditis ...
NP_001309465 166 DAYADHYFRAEMHKRYRLNISEVACFSLVAY--NFDN--T--PRWRNILCTISLFCIMLIQYTIIIYCATIMYLKMeEKL 239 Caenorhabditis ...
CAP30495     242 PQEgeSAFTKSLQKQLYKALVLQAMIPILFMYLPIGTFLMLPAFNVNIEsFSKLATLFYAVYPAVDPLPLFFVIDNYRYA 321 Caenorhabditis ...
O76658       232 SST--SNQYQKLQHQFFKALIYQLAAPCICFHIPSFFFYIAPFFELEISfRSTIIIYGFNVYPLTDSLILLTVISEYKIA 309 Caenorhabditis ...
O17716       244 QLV--SASLRELHRQFFKTLIMQILSPTICLFAPVVFIIYLPIFNFEVSiPTGMFLCAFTLYPALDALIIMYIVKDYRKS 321 Caenorhabditis ...
XP_002637697 241 KML--SVSLRNLHKQFYKTLLLQIFTPTLCLFAPVVFIIYLPLFDLKISiPTGMFLCAFTLYPALDAMIVMYIVTDYRNA 318 Caenorhabditis ...
O62017       237 KNF--SETLRKHHKQFFKTLVLQITTPTIILFIPITIIIFLPLFHLDVSlPSGVMLCSFTLYPAADSFIVMFVVSEYKNT 314 Caenorhabditis ...
O17896       235 SVL--SAQNRRLHKQFFRALVIQITAPTIILFCPVFFMIYAPFADLEMSfPSCIIQSGFTVYPALDSIIMMSCVSEYGRA 312 Caenorhabditis ...
O45809       233 SML--SETSKRLHTQFFKALILQIVVPTILLFFPMIIIIYLPVFNLKFSfPTGILFSAFAIYPSIDIAIILYIVSDYRIA 310 Caenorhabditis ...
XP_002637694 233 SML--SETSRRLHTQFFKSLVLQIVVPTFLLFLPMIIIIYLPLFNLEFSfPTGILFSAFAIYPAIDIAIILYIVCDYRNA 310 Caenorhabditis ...
P91984       233 EQF--SITNRKMHKQLFKTLVVQITVPTFTIFMPVMFMFLIPFFDLQLGiPTGVLLCALSLYPFIDGLIVISIVSDYRKA 310 Caenorhabditis ...
NP_001309465 240 KLL--SVSIRNLHRQFYKTLVIQIFTPTICLFSPLIFIIFHPLFNVEIVvPTGMLLCAITIYPAVDAIIIMYVVTDYRNA 317 Caenorhabditis ...
CAP30495     322 LK 323 Caenorhabditis briggsae
O76658       310 LK 311 Caenorhabditis elegans
O17716       322 AK 323 Caenorhabditis elegans
XP_002637697 319 AK 320 Caenorhabditis briggsae
O62017       315 VK 316 Caenorhabditis elegans
O17896       313 LK 314 Caenorhabditis elegans
O45809       311 IK 312 Caenorhabditis elegans
XP_002637694 311 IK 312 Caenorhabditis briggsae
P91984       311 AI 312 Caenorhabditis elegans
NP_001309465 318 IK 319 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap