Conserved Protein Domain Family
7TM_GPCR_Srw

?
pfam10324: 7TM_GPCR_Srw 
Serpentine type 7TM GPCR chemoreceptor Srw
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srw is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz.
Statistics
?
PSSM-Id: 402097
View PSSM: pfam10324
Aligned: 85 rows
Threshold Bit Score: 205.132
Threshold Setting Gi: 75012603
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9U2P2        37 PFTF---IFSCFGFLINIFHLITITRKSLRANSVYVLMIGITSSDLYTMFHINYVYIDTIISTylhn---kmyeGYKCWy 110 Caenorhabditis ...
CAP26763      25 IFNYticIMQFFGFAINLIHISILTRPQMRSNAVYRLMIGICCCDLLTQINTFLIFSPFWIRNls-------kpEDECY- 96  Caenorhabditis ...
CAP26762      27 IFEYvlaILQFFGFFINLVHLSVLTREDLRMNSVYRLMIGICSCDLISHTLTFIGFSPFWIKEvr-------keSQKCF- 98  Caenorhabditis ...
O45170        30 KLNFvlaILQFFGFGINLVHFSILSRKHLRTNSVYRLMIGICSCDIISHTLTFLAFSPFWIREvr-------kkNQECF- 101 Caenorhabditis ...
Q9U8C4        39 PFQC---LFALIGLIMNMFHLAIITRKSMRTNSVYVLMIGITISDMFTMFMVVYNNFNDFFK------------FVFCS- 102 Caenorhabditis ...
CAP34788      16 KFEF---FAKPFYALLSMFIAFVLST-------------------IMTLLFWSRYELVEVKAWt---------pPVNCI- 63  Caenorhabditis ...
Q19558        37 HYEY---YVAWIGAIVNVLHLYILSRKSIRCNSINIFLMGTGICDMFCLCLFIHAYTLTLIFP-----------DDRCW- 101 Caenorhabditis ...
Q19562        37 EIHL---LLACIGAVVNVFHLLILTRKSMSNNSINLMMIGISVCDIFIMSFCVYDILDTLLQK-----------YDECA- 101 Caenorhabditis ...
O76620        37 NAYN---WLACVAVFINCIHLSILTRKSMGLNSINIIMIGICICDLVNMSYAIYDIIFLIVHP-----------NDKCT- 101 Caenorhabditis ...
NP_001255885  37 KYQC---VFSCSGLLINLVHLIIITRKSLRVNSVYVIMIGITLSDLYTMFHVVYVFLDNIVSNynwyecfqvctEQECFk 113 Caenorhabditis ...
Q9U2P2       111 i-srVTHGYFHVLCELLMRALGDILRRLSTWLALFMALFRFLIIQFSMNAKFNFVSTPKFALKTIIATFLISFLLTLFAY 189 Caenorhabditis ...
CAP26763      97 ----MTHTFFDALLYLHGTTVLDITQRGASWMALLMALFRMLSVKFPLNAKIQKISRPVFALWTILAVIIFTSLTTWMVQ 172 Caenorhabditis ...
CAP26762      99 ----LTMSYKDAFLSLYPVVVLDITQRTSSWLALAMALYRTLSVMFPMSARMQKMSKPKWAVWTILVLLLVNTSWTLVVF 174 Caenorhabditis ...
O45170       102 ----LTMTYRDAVLLLYPVIVLDITQRSSSWLAVLMALYRTLSVKYPMSTKMHKVSNPKWALWTIIGVLVVNTAWTLVVF 177 Caenorhabditis ...
Q9U8C4       103 ----FPDPYWKVLLELILAAIQEIVRRVSTWLAFFMALFRWLIIKNTMSGSLGFLSKSSFALKTNIGVLILSTIITSLTY 178 Caenorhabditis ...
CAP34788      64 ----GFPPGYTVPRYK--------SSMDDAWLLKPMLSLQIFSVI---DGLIKIIPTLMFPILTVILVRELKKAADSRKK 128 Caenorhabditis ...
Q19558       102 ----NYHSYINVFIEVWVSSLNDVLRRASAWLSVMMALTRFLIMKNSLNPKYQFLSKPKFALISMFLAFWVSLLVSVFYL 177 Caenorhabditis ...
Q19562       102 ----PPQSYFSKIFDFWASALEDHSRRLSAWYGVMMALMRFLIVKFALNPKYDALSKPLFSYLSMFIAFLVSTGMTLFFW 177 Caenorhabditis ...
O76620       102 ----PPLSYAMELLDYWLLSFQDITRRMTSFFGVLMTIVRFFIIKFALNRKFDTISKARFAICSIAIGFVLSSGITLFFW 177 Caenorhabditis ...
NP_001255885 114 fhkyQYHGYLHVVVELIMSALREALRRLSTWLAFCMALFRWLIIRNSMNAKFDFLSRPSFAFKTVLTLLLISPIITFLSF 193 Caenorhabditis ...
Q9U2P2       190 iGQYRVvEDGLQASLY--CEep-lDFEVPHTYIVGNSRIFDDYWPVVVK-YSLMSEGITKIIPAVTLPFLTIGLIKCLHE 265 Caenorhabditis ...
CAP26763     173 -ARRIIrDYDWDYD----CDkn-eIHLNQTRYGVLIPEEYIDIQARLVS-IYGFi----KALPSLIDPILTVFLVLELRK 241 Caenorhabditis ...
CAP26762     175 -GRHAIvERNIDTD----CDgn-eVHLNPVRYLILVQTNLEHLHSTITY-IYGFi----KALPSLIDPILTVLLIIELRK 243 Caenorhabditis ...
O45170       178 -GRHKIdGRNIDYD----CDgn-eVHLSQLRFMVLVDTSLEHLHSIITS-IYGIi----KALPSLIDPILTVLLIIELRK 246 Caenorhabditis ...
Q9U8C4       179 -SQKEVkDVGFEVIST--CWflekNYKIAHTYSVGRSEFMDKNLNFVEE-YAFMSDGIPKMIAAFFLPILAIALVRRLRQ 254 Caenorhabditis ...
CAP34788     129 -ASVGSeKHEENSK----------SH-QATKLVILMTITYMAAEGPLGI-IYVV-QGFI--IPTLMFPILTVILVRELKK 192 Caenorhabditis ...
Q19558       178 -IRVTItEVE-PWTPAdyCAdy-lATYSEKQYSSSVTKYFEANIVAAVQ-IFLVMDGLSKTIPAAILPTLTVLLIRELKV 253 Caenorhabditis ...
Q19562       178 -GRYEFtAKE-VWTPPkeCTqy-pLGFTLPLYKSSLDDIYLIDASVALI-VFSIIDGLLKIIPALMFPVITFLLIKELRT 253 Caenorhabditis ...
O76620       178 -LRYEFvEVK-PWIPPkkCSqf-pPNYTVSEYMSTMAKAYSKADQTPLLtVFTILDGLSKIIPAVIYPIFTFLLIQQLRA 254 Caenorhabditis ...
NP_001255885 194 -GQHTVtDNGFVDVs--qCSgi-pDYIVPHTYIIKKGRVFDDFWPLAVQ-LYFFSDGISKIIPAVCLPFLCIVLVTCLRT 268 Caenorhabditis ...
Q9U2P2       266 ASRARQKLNs--pHKN--A--SNDKSVKMVAIMTIFSMIAESPSGIIHTYQFFYYDYSsiITCVKSLDKLFINLSILNAI 339 Caenorhabditis ...
CAP26763     242 ASRRRKNCG----KSLtvD--KTDNTTKLVAFVTISFFLLEVPNGFSHIVNGLFQDNVpvRTISVMIPVFAECLPIINSS 315 Caenorhabditis ...
CAP26762     244 AAKRSKKCG----KPS-----NSENTTKLILFVTISFFILEVPNGFAHVTAGVFHGVPeiLSVSYMVQVFAEILPVFNSS 314 Caenorhabditis ...
O45170       247 ASKRRKNIG----KEDc-G--KSDNTTKLVLFVTISFFILEVPNGFAHVTAGAFHGNPgiLTISYMIQVFAEILPVFNSS 319 Caenorhabditis ...
Q9U8C4       255 AAESRKHLSn--sKPL-----QTDKSIRMVTFMTLFSVFAEGPMGIFSFIRSFYLRFSsiEASVESLDKMLINLVIVNVI 327 Caenorhabditis ...
CAP34788     193 AADSRKKASvgseKHE--EnsKSHQATKLVILMTITYMAAEGPLGIIYVVQGFVTQPPgiVEMTMDLIDIFGVFVSINAI 270 Caenorhabditis ...
Q19558       254 ASDSKRKISv--aMRKgnensKTDHTTKMVILMTICFMSAEGPMGICTVVQGFVVEKSgyLGITFDLVVIFGLFVTINAI 331 Caenorhabditis ...
Q19562       254 AESIRRKTSq--gSFKkd-saASEQTTKLVILMAITFIAAELPIGAIYVAQGVLINQPviVEITYELVDVLGIFVAINAT 330 Caenorhabditis ...
O76620       255 AIALRRKTSt--sMGSrlestKSDQTTKMVILMTVTFTISEGPIGICYILEGTLPKRSvfRDINYDLMDAFTIFVAINAS 332 Caenorhabditis ...
NP_001255885 269 ARESRKNLS----KSSs----NNDRTIYMVTIMTAFSVFAEGPSGISYLFKALYYDHNaiKSALQTLDEILINAAILNSI 340 Caenorhabditis ...
Q9U2P2       340 VHCVISFRVSTQYREVAKKLFSFK 363 Caenorhabditis elegans
CAP26763     316 SHFFVCLLMSTQYRETARTVFKCF 339 Caenorhabditis briggsae
CAP26762     315 SHFFICYFMSSQYKSTVKEVYGRF 338 Caenorhabditis briggsae
O45170       320 SHIFICLAMSSQYRETSCEIFCGE 343 Caenorhabditis elegans
Q9U8C4       328 AHCFISMQMSSQYRDIATQLFLRK 351 Caenorhabditis elegans
CAP34788     271 MHCVIYLTVSSQYQKSAKSLFCCV 294 Caenorhabditis briggsae
Q19558       332 SHCLICLAVSTQYRKCAKKVFCWD 355 Caenorhabditis elegans
Q19562       331 THCLICLGVSSQYRRTVKALFKFC 354 Caenorhabditis elegans
O76620       333 VHFLICLGVHSQYRKSAKELLFCE 356 Caenorhabditis elegans
NP_001255885 341 VHVIISLVVSTQYRETAKKLFGCK 364 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap