Conserved Protein Domain Family
DUF5427

?
pfam10310: DUF5427 
Family of unknown function (DUF5427)
This is a domain of unknown function. Family members found in Saccharomyces cerevisiae, are synthetic lethal with genes involved in maintenance of telomere capping. However, experimental evidence is yet to verify the exact function of family members and the domain.
Statistics
?
PSSM-Id: 402088
View PSSM: pfam10310
Aligned: 72 rows
Threshold Bit Score: 195.248
Threshold Setting Gi: 685953513
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007797603  19 EGIG-DDSAVKK--------------PTKAKSTAPKSrggdKHEkDPLAELEnEL-EevpsrphtprvrDAv-------s 75  Eutypa lata UCREL1
XP_004180572  17 DSLPqSGqngdk---------sdsmkDSKDLGSSKAGsntkKDE-DILDFLD-ELeK------------SNlsln-keks 72  Tetrapisispora ...
CCC67528      18 ESLPeTSsn---------------gnQDDKTKDATKKdpqkKDE-DIMDFLD-ELeK------------STadls-ekkd 67  Naumovozyma cas...
CCK73593      18 ESLPsENatd-------------ksiDDTNDNKGKTNeggaGDE-DIMDFLD-ELeK------------SNlsie-kpsk 69  Naumovozyma dai...
CAR24033      33 ESLPeSSk------------------TSGGSGAENSGkepkKDT-EILDFLD-ELeQ------------SNlslk-kdkk 79  Lachancea therm...
EDO18125      17 DSLPeAK---------------------KNDQNDQSKdngkKDE-DILDFLD-ELeK------------SNle------l 55  Vanderwaltozyma...
XP_002496584  15 ESLPeAKggad------------skgDKKEKTEEKKSggkqGNE-DIMDFLD-ELeK------------SNlsvpkkeea 68  Zygosaccharomyc...
P47018        17 DSLPeAKNGGKMvntdvkgsqegvkgGSNSVAGKTGNdgkkGDD-DIFEFLE-ELeK------------SNlslt-dkkg 81  Saccharomyces c...
Q6FL79        18 DSLPeDK--------------------KGAEGKSKAKgagkKDEeDVFEFLE-ELeK------------SKmdlg-akkg 63  [Candida] glabrata
XP_003958344  18 ESLPnDG--------------------ANEKVDDGNKkkgnKDE-DIFEFLD-ELeK------------SNlks----kg 59  Kazachstania af...
XP_007797603  76 SKRT--------------STATPppg----aprQSEDKstn-------------lpRKSveSTR--SFHA-SFTPSATSS 121 Eutypa lata UCREL1
XP_004180572  73 EGSKvsktktenddkivkNDSSPavienssstsSTQMGk----------------kDQNedSLKkeELKQsDEEKEEEee 136 Tetrapisispora ...
CCC67528      68 KKQTkkveervktedqpvQKEEKekeeskekitAE-------------------------------TAKTpEQEQEEEQV 116 Naumovozyma cas...
CCK73593      70 KKKGltgnsadktgqqsaKEEGKektekvsptiTKEKEeevisg-----------------keeeeNQEQgHEEEEEEEV 132 Naumovozyma dai...
CAR24033      80 AGqae-----------enAQEGEgdsvaqtstaSKEPAaaekpaaa--------ekpvaaeEPA--AVEDpASSKASQPK 138 Lachancea therm...
EDO18125      56 NKNKtnsgdsannnknkkKASNNtkqeskpqsvGKEETkkapiknneqkpvkeeikEVPldEVT--NKEEsINENQEQDS 133 Vanderwaltozyma...
XP_002496584  69 QEKKkeeiskmkpskeepSKEEPpkeeppkeeaPKQELpkqepl-----------------keeapKQEPpKKEQPKEVP 131 Zygosaccharomyc...
P47018        82 VEKKapsesvnnkaqdekVEESKenknseqdahGKEKEp--------------------------qQQEKeEEEEEEEEE 135 Saccharomyces c...
Q6FL79        64 KKVAetkkldpqesndgkAKSETkqe--------------------------------------apAVKKdTEEKSEEAS 105 [Candida] glabrata
XP_003958344  60 KEAKvarkqeqplekegaKQEPEetkpkevepvSNE------------------------------TVSKgTVENPEEne 109 Kazachstania af...
XP_007797603 122 -ELQDAEKKgp---------veQAAPAASGGAGGGWWGGifatasaTANAAMKQAEAaykeiQKNEEAK----KWAEQVR 187 Eutypa lata UCREL1
XP_004180572 137 ea----------------deplG----DPISTFSNWWSS-------SGSATVSSFWN-----KTTEQAS----QLKNHLS 180 Tetrapisispora ...
CCC67528     117 n--------------------------DPITSFSNWWSS-------SGSNTVSSLWN-----KTTEQASthlkKVTERIN 158 Naumovozyma cas...
CCK73593     133 eqgrd-------------gtplN----DPITSISNWWSS-------SGQATVSTLWD-----KTTKQATsqikKIGDKIG 183 Naumovozyma dai...
CAR24033     139 eTAASVSQAdaeiiqs-----epettsDPITSFSNWWSS-------SGSATVNSFFS-----KTAEQAT----HLKDRLA 197 Lachancea therm...
EDO18125     134 vpke--------------gtplN----DPITSFSNWWSS-------SGSAAVTNIWN-----KTQKQAS----ELQKKIV 179 Vanderwaltozyma...
XP_002496584 132 pKESKGFHRegtpvesredtplN----DPITSFSNWWSS-------SGSATVSNFWS-----KTTEQAS----QIKTRLA 191 Zygosaccharomyc...
P47018       136 eeeee-------------etplH----DPIASISNWWSS-------SGSAKVSSIWN-----KTAEQAS----QIKNRLA 182 Saccharomyces c...
Q6FL79       106 nAKVeane----------etskQGTNPDPIASISSWWSS-------AGSATVSSLWS-----KTTEHAS----QIKNRIQ 159 [Candida] glabrata
XP_003958344 110 qd----------------geplN----DPITSISNWWTS-------SGSTAVSNLWS-----KTTEQAS----KVKDRIQ 153 Kazachstania af...
XP_007797603 188 G-----NVGALKGL-GDDLRHR------------------ALPTIADIMHTLAPPI--SSHERLLIHITHDIVGYPSLDP 241 Eutypa lata UCREL1
XP_004180572 181 Q-----EQQ---DFiAQSANRVkninmnkvvdmnvvnsvvNKSKITELAKNLQKIVvgETEEVLRIHLVHDLVNYPNLQY 252 Tetrapisispora ...
CCC67528     159 Q-----EQQMEDSI-ASKLTKNl-----------------NPIKISELAKSLSKIVvgDTEEILRIHLVHDLINYSYLQY 215 Naumovozyma cas...
CCK73593     184 Q-----DQL------LQQSRGA--------------------IKITELAKNLSKIVvgETDEILRIHLVHDLINYSYLQY 232 Naumovozyma dai...
CAR24033     198 Q-----EQH---GI-ASKLQGTslg------------skiNTATLSTLAKNLSRIVvgDTDEVLRIHLVHDLVNYPLLSY 256 Lachancea therm...
EDO18125     180 DeqsqiPIKELTSL-TSKLKTS---------------------TITDLANRLQEIVvgETEEVLRIHLVHDLVNYPLLQY 237 Vanderwaltozyma...
XP_002496584 192 Q-----EQL---DL-TSRLNTN---------------------TITDLARNLQKIVvgETEEVLRIHLVHDLVNFSFLQT 241 Zygosaccharomyc...
P47018       183 Q-----EQL---DL-TSKINTS---------------------TITEIARNLQKIVvgETEEVLRIHLVHDLVNYPSLQY 232 Saccharomyces c...
Q6FL79       160 Q-----EQL---DI-TSKLNTQ---------------------TITDLARNIQKIVvgETDEVLRIHLVHDLVKFPSLQY 209 [Candida] glabrata
XP_003958344 154 K-----EQQ---TL-TTTLPIKi-----------------NTNTISELAKNLSRIVvgETEEVLRIHLVHDLVNYSNLQY 207 Kazachstania af...
XP_007797603 242 LIYEVFSRVM-SQVEGGDLLVIQRGQESTA---RRasdvtytkhsSSSSVAGWRDGPWWRqv--dAP-RNL--GAVRG-L 311 Eutypa lata UCREL1
XP_004180572 253 IIHEKFNQILnEQVQGGIRIFVDEWGKPNSnsnLNll-------nlANKNINNQLNNIANnininSLpPNF--NVFHGkI 323 Tetrapisispora ...
CCC67528     216 QIETKFDQVLsSQVQGGIRIFVDEWGNPNKkmdSSitnefn---------------------dakflkRKL--NLFNGkI 272 Naumovozyma cas...
CCK73593     233 QIEDKFHQVLsSQVQGGVRIFVDEWGNPNKkdtGRrstitdf-------------------neakflkQKL--NLFRGkT 291 Naumovozyma dai...
CAR24033     257 HVEQQFDNVLsSQVQSGVRIFVDEWDHPIEgndRVqd-----------------------------gkRHL--NMFTGkV 305 Lachancea therm...
EDO18125     238 HVEQKFHDVLsSQVQGGIRIFVDEWTNPNErelYEke------vePTSKESKK---------------RQL--NMFNGkV 294 Vanderwaltozyma...
XP_002496584 242 IVDQKFDEVFsSQVQGGIRVFSDQWGHPHRtedEMnfhf-------------------------tsqqPKL--NIFTGkI 294 Zygosaccharomyc...
P47018       233 NIESKFDQVLsSQVEGGIRIFVDEWGHPNNngiTPve------kkPSVADGELGNSK-----------KKLqfNLFDGkV 295 Saccharomyces c...
Q6FL79       210 HIENRFDQVMsSQVEGGIRIFVDEWGRPNRsnsIStv------vdPEKREHEEKDAIEPK--------IKL--NLFSGkV 273 [Candida] glabrata
XP_003958344 208 YVESKFDQVLsSQVQGGIRIFVDEWGKPHQddtTTisfi-------------------------ndnrRSL--NLFVGkI 260 Kazachstania af...
XP_007797603 312 PEGTKLCRVGAESYAHDYFAGRGGIA-----------------EAQRRALEPVSDENPVRTSDIFLAVQAITVDATPalf 374 Eutypa lata UCREL1
XP_004180572 324 IDGEKLAFANLDNAIELFNKAQKEIQnqqnea-----kkeaneATATNDNDEDEDEQIANIIDIFISILPIAPSSSS--- 395 Tetrapisispora ...
CCC67528     273 NDGEKLAFANLDNSIKLFNKAHEEIMkqk------------keNEKQEGKDGKDENDQNKISDIFIAILPIAIPNTG--- 337 Naumovozyma cas...
CCK73593     292 TDGEKLALANLENSIKLFNKAHDELLkrkkel-----nekddeNSENDDDDEEEEEEQNKISDIFIAILPIAVEEKG--- 363 Naumovozyma dai...
CAR24033     306 SDGEKLAFANLNNAIKLFTEAKDELAkqr-----------------feTVSAEEGEKELAISDVFISILPISVPEKH--- 365 Lachancea therm...
EDO18125     295 VEGEKLAFANLDNAIKLFHKSRENIIkqqkeak----laetdqDQESKQSDTEAGDEEDNISDIFISILPVSVPGTN--- 367 Vanderwaltozyma...
XP_002496584 295 TDGEKLAFANLENSIKLFQKAHEEFMrqkeahstatnerqeqeQDGEDADDDEKDDQEDRISDIFISILPIAIPTKQ--- 371 Zygosaccharomyc...
P47018       296 TDGEKLAFANLENAVKLFNTAHEEYQkqq-----------keaDATPDDDRSSISSNSNKISDLFISILPIAIPQKQ--- 361 Saccharomyces c...
Q6FL79       274 SDGEKLAFANIDNSIKLFNKAHDEYIrqq------------keAEGESEEGSSAEKSENRISDIFVSILPVAIPDKN--- 338 [Candida] glabrata
XP_003958344 261 TDGEKLAFANLDNAIKLFNKAQEEISkqqk----------eaaDGDDENEKNTNEDTKDNISDIFISILPISIPISG--- 327 Kazachstania af...
XP_007797603 375 agstAE-KAEKESSg----vADDDESsaadAHVCFAVYVLDPVHEIVYSTVSQALPARWIRWLDTPsattttattssgpT 449 Eutypa lata UCREL1
XP_004180572 396 -----AkMDDDKSTi----iTDTTHS----GNFSFTIILKDISNDITSITRSQGFPLKWLKWIENS-------------K 449 Tetrapisispora ...
CCC67528     338 ---------KDDDIi----tTDPSHP----GNFNFTIVLKDITNNITTITRSQGFPLKWVKWLENY-------------N 387 Naumovozyma cas...
CCK73593     364 -----KtSSDDKDIi----tTDASYP----GNFNFTIVLKDITNNITTITRSQGFPLKWVKWLETE-------------K 417 Naumovozyma dai...
CAR24033     366 -----Kn----PEIa----tTDSSHP----GNFAFTIVLKDISNDFTSITRSQGFPQRWADWLEGT-------------S 415 Lachancea therm...
EDO18125     368 ----KD-----DPIk----tTDGNAP----GNFSFIIVLKDITNDITSITRSQGYPSKWAGWLEGS-------------Y 417 Vanderwaltozyma...
XP_002496584 372 --------EDENEIv----tTDPHQP----GNFSFTVVLKDITNDVSTITRSQSFPLKWVSWLEGD-------------S 422 Zygosaccharomyc...
P47018       362 -----------KDAdgdfqvTDSNTP----GNFNFTLVLKDITNDITTITRSQGFPVKWVNWLEGS-------------V 413 Saccharomyces c...
Q6FL79       339 -----------DSTkedmivTDPHHA----GNFSFTVVLKDISNDITAITRSQAFPTSWVEWLEGE-------------T 390 [Candida] glabrata
XP_003958344 328 -----SkDVETDDIl----tTDSSQS----GNFNFTIVLRDITNNITTITRSQGFPNKWAEWLEGT-------------K 381 Kazachstania af...
XP_007797603 450 PKASG-----------SGDSeeeesseeeeeddddeegnerpppqrqtggarggggaaigvegdglSIPDEIRAIVEGGG 518 Eutypa lata UCREL1
XP_004180572 450 DEEDNekdssksenatLTQKtten---------------------------------------ketKGNDETDDEDEDDG 490 Tetrapisispora ...
CCC67528     388 DDEGEdadadadtnekTN------------------------------------------------RDKEEEEEEEEELG 419 Naumovozyma cas...
CCK73593     418 DKGEEea----------------------------------------------------------kEEAADEEAKEEELG 439 Naumovozyma dai...
CAR24033     416 ELKSKqdaiqd--------------------------------------------------reskrDAVERTDSADDAEG 445 Lachancea therm...
EDO18125     418 ELTSKddaisqakekdEKKKqs------------------------------------------ssNEEDEEDEEDESNN 455 Vanderwaltozyma...
XP_002496584 423 EWKTKgkkeqegkeqeGKQQq---------------------------------------------QQQQQQQEDDEDED 457 Zygosaccharomyc...
P47018       414 EKTGStaseernksydQK------------------------------------------------KQKESEDEDEDDEI 445 Saccharomyces c...
Q6FL79       391 KKNKE-------------------------------------------------------------SKKGDDNEDEEDDI 409 [Candida] glabrata
XP_003958344 382 DEDNTkqeekskkeeeE-------------------------------------------------EEEEKEPANDEEGE 412 Kazachstania af...
XP_007797603 519 VDPREWVAEWVEETLTLSIGVLAQRYVARRMGV 551 Eutypa lata UCREL1
XP_004180572 491 VNPAEWVQNWVDDGINLAFGTAAQNYVLERMDf 523 Tetrapisispora blattae CBS 6284
CCC67528     420 VDPGDWVKEWIEDGLNLAFGIVAQNYVIQRMGF 452 Naumovozyma castellii CBS 4309
CCK73593     440 VDPGDWVKDWIEDGLNLSFGIVAQNYVIQRMGF 472 Naumovozyma dairenensis CBS 421
CAR24033     446 IDPSDWVKEWVEDGLSLAFGVVAQNYVIDRMGF 478 Lachancea thermotolerans CBS 6340
EDO18125     456 IDPSEWVKEWIEDGLSLTFGIAAQNYVIERMGF 488 Vanderwaltozyma polyspora DSM 70294
XP_002496584 458 VDPSDWVRDWVEDGLNVAFGVVAQNYVIKRMGF 490 Zygosaccharomyces rouxii
P47018       446 IDPSEWVKEWIEDGLSLSFGVMAQNYVIDRMGL 478 Saccharomyces cerevisiae S288C
Q6FL79       410 VDPGEWVKDWIEDGLSLSLGILAQTYVIKRMGL 442 [Candida] glabrata
XP_003958344 413 IDPSDWVRDWIEDGLSLVFGVVAQNYVIDRMGL 445 Kazachstania africana CBS 2517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap