Conserved Protein Domain Family
RTP1_C2

?
pfam10304: RTP1_C2 
Required for nuclear transport of RNA pol II C-terminus 2
This domain is found towards the C-terminus of required for the nuclear transport of RNA pol II protein (RTP1). RTP1 is required for the nuclear localization of RNA polymerase II. This family is found in association with pfam10363.
Statistics
?
PSSM-Id: 402083
View PSSM: pfam10304
Aligned: 63 rows
Threshold Bit Score: 37.3601
Threshold Setting Gi: 195387962
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002052661  849 LPIYRLLRAIEANESCDpQMRQHAANGLKILNE 881  Drosophila virilis
CCF54300     1259 QRLKQVAAYLVANDSDA-ILRTHAYDCLQHVEA 1290 Ustilago hordei
EST06095     1007 DRLKQVAAYVEAGDTDS-IVRTHAHDCIEHVDA 1038 Kalmanozyma brasiliensis GHG001
EPB91501      930 RRTYRTLRYIEETDPDE-LTRYQARVALSDLDA 961  Mucor circinelloides f. circinelloides 1006PhL
EFA77562     1002 RTLYNRLKTLESTDTDT-ICKYHARNALAELDT 1033 Heterostelium album PN500
XP_003292375  405 KEIYNTLKKTEFYDPDE-ICKYHARAALYDLET 436  Dictyostelium purpureum
Q54Y12        408 KSIYNTLKNVEFYDQDE-VCKYHARSTLYDLEK 439  Dictyostelium discoideum AX4
EFN73056      875 VDLYRGLKHLRDNDDDP-VLRLHAQLALEEIDH 906  Florida carpenter ant
EGT33757      911 LDLYREVRTLHTTDRDD-TVRLHAQLCLEEINA 942  Caenorhabditis brenneri
BAP68775     1037 LPLYRTLKHVARVDRDD-VVVFHANRALTALDd 1068 Hyaloperonospora arabidopsidis Emoy2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap