Conserved Protein Domain Family
MMADHC

?
pfam10229: MMADHC 
Methylmalonic aciduria and homocystinuria type D protein
This entry represents methylmalonic aciduria and homocystinuria type D protein and homologs. These proteins are involved in cobalamin (vitamin B12) metabolism.
Statistics
?
PSSM-Id: 402023
View PSSM: pfam10229
Aligned: 18 rows
Threshold Bit Score: 277.77
Threshold Setting Gi: 121993659
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015213734  24 RIAGARCFSaaGSSGSDEPY-VAITPLDIGLRTVWPDEKMGPF--------------------------GPQDQRFQLPG 76  spotted gar
NP_991157     24 RVVGARSFS--GASGSDEPH-LNTSTPDIAPRTVWPDESMGPF--------------------------GPQDKRFQLPG 74  zebrafish
CAF95981      24 NMSAARSLCfaGDSGSNQPH-ETIVPLNLGLWAGGPDDRKGSF--------------------------GAQDR--QLPT 74  spotted green p...
Q9W375        22 TVHRGSNRLndLLSTKVTNT-AIIPVARYSKRNGPPSDAGGYFktvksrdlddddelnslesepnweltAERGNRFYLPN 100 fruit fly
Q9XWC9         5 KGPQMRAFTqrVAAFSTQLQ-IDPIPIVFVGKGTTP-RQNSLL--------------------------GPNDSQYPFQG 56  Caenorhabditis ...
EFX90029      26 qqphgKHFSsqGSGDKRHPHaIVLLDENADGTTVWPDPSLGLL--------------------------GPKDLRMPLPG 79  common water flea
XP_003456271  26 RVAGGRAFTaaDSSGLKEPA-LASAPSAKGLQTLRPDEMMGPF--------------------------GPQDQRFLLPG 78  Nile tilapia
1_pfamImport   1 RVTGTRNFSatGSSSSHELC-VAITPSEMA----WPDEIMGPF--------------------------GPQDHRFQLPG 49 
CAG01007      22 HVGRTRTFSaaS---SDEPY-THVSLTVSGPRTVWPDESMGPF--------------------------GPQDQRFQLPG 71  spotted green p...
XP_004066619  27 rpatVRPFSaaS---SDEPY-IAVSPADSGPRTVWPDDSMGPF--------------------------GPQDQRFQLPG 76  Japanese medaka
XP_015213734  77 NVGFGCHLEGTADQKQTPVHRPVPDVLSAPSSSERHEFILAQFVSEHQEKEVAPTSEQVNKAEKYFEMSN---------- 146 spotted gar
NP_991157     75 NVGFDCHLESPVEQRTTSVHSVMPDVLTAQSNNQRHDFILAQFINELHEDDKTSTAQNMDKAEQFFDHSS---------- 144 zebrafish
CAF95981      75 NL-LSCDLRGAAGQQRCLDSTVLP------IQARRSDLTMTEVLEEPLVTEELPR----SPPEAYFDGST---------- 133 spotted green p...
Q9W375       101 GIG-------------------------PAWQGDSTTVGLLEPLGHLVNFHKGPNTDKSR-------------------- 135 fruit fly
Q9XWC9        57 DVSFAHKPLSIRQQVENSKIERVMDD-------TEHNLINLLSNTNIEVDRTHLAQLKEEAMEEIQANAAdv-------- 121 Caenorhabditis ...
EFX90029      80 NVGFS--------------HRISPSVLPATVQSTKKTWQDTELFSTLTNYERQYQVVKQSAQEDLDELNSteieellldl 145 common water flea
XP_003456271  79 NVGFDCQLEGETEQQKSLTDKMLPDVLSAPSCYEKHEWLLAPSVGELSNKGDPASSDKVSTAEHYFDNSR---------- 148 Nile tilapia
1_pfamImport  50 NLGFDCDLQGIAEQMKSLAHSKVPDVLSSPPSSEQHELILAQVNRDSFEEDEPASSQDVHTADRYFDSSS---------- 119
CAG01007      72 NVGFDSHLDGTAGQKKTVVHRTVPDVLTAPSSTERQQFILAQFVNEFHGN-LDPVSTRVHKAEQYFNPAG---------- 140 spotted green p...
XP_004066619  77 NVGFDCHLEGMGNRPKTPVHKTVPDILTAPSSAERQQFILAQFVNEFQGK-LGPISGRVHKAEQYFNQAD---------- 145 Japanese medaka
XP_015213734 147 ------VECAIQTCPVLLKKDVEAMFP-EAPAG---TQTVVTVTQKTQQDMTAWSEAVQVERETLLEKFVSGAKEICYAL 216 spotted gar
NP_991157    145 ------VECAIQSCPELLKRDFESMFP-EAPST---GMMVVTVTQRTQNDMTAWTEQVDQEREELLAKFIEGAKEICHAL 214 zebrafish
CAF95981     134 ------VECAVQFCPDQLRDDFRCIFP-EAPSS---GMTVVTVTQKTQNDMTSWSCAVEQEREQMLAKFIDGAKEICSVL 203 spotted green p...
Q9W375       136 ------LEFTCCKCPLLIRVPLLEIFPvPVVAQqciNITMLVLSHEGDIEMGA-------------AKFVLAAREMCDRL 196 fruit fly
Q9XWC9       122 -----eIELSAIEAPKLLKKEMKYLFP-QMETQkmnNVTVFNLTQKSEFDMKAWSEAMEEEREKLTASFIMSANAICSTL 195 Caenorhabditis ...
EFX90029     146 pqpsdvLECVAQDCPKLVRKDFADLFP-SRDVTf-gPLTVVTLAQKTKSDMSSWSEVVEYEREELVACFVDAAKEICEQL 223 common water flea
XP_003456271 149 ------VECATQACPELLKKDFQSMFP-EAPSC---GMMVVTVTQKTQNDMASWSAEVEDEREQMLDKFVAGARDICCAL 218 Nile tilapia
1_pfamImport 120 ------LECAVQCCPELLKKDFQSMFP-EAPST---GMMVVTVTQKTRNDMTSWCAEVEQERDQMLDKFCDGAQEICHAL 189
CAG01007     141 ------ADCSINSCPELLRRDLELLFP-SAPTN---PITVVTVTHRSSQC----GEAPEQDRDQLLQRFVNGAKEMCFSL 206 spotted green p...
XP_004066619 146 ------ADCSINSCPELLRKELEQLFP-SAPAA---SITVVTVAQKDSRRF---AETPDLDQEHVLHKFVSGAKEMCFAL 212 Japanese medaka
XP_015213734 217 QTAGYWADFIDPSSGLAYFGSYTNNVLFETDERYRHLGFQIEDLGCCKVIRHTLWGTHAFVGSLFTNAPPESLIMKKLQ 295 spotted gar
NP_991157    215 RNEGFWADFIDPSSGLAYFGSYTNNTLFETDDRYRHLGFQIEDLGCCKVIRHVMWGTHAFVGTLFTSAPPNSQIMKKLQ 293 zebrafish
CAF95981     204 QTEGFWADFIDPSSGLAFFGPYTNNTLFETDDRYRHLGFHIEDLGCCRVIQHSLWGTHVFVGTIFTSAAPDSHIMERLL 282 spotted green pu...
Q9W375       197 LSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFRGLNMRLSEQNRCTVISAEKNDSTRFSGTIYSTAPNHYGQLMKLL 275 fruit fly
Q9XWC9       196 HRFGYWADFIDPSSGRPYMGDYTNHTLFETNDAYKQMGFKIEDLGCCKVLQHACWGSNAFVGTIFTDAPVDGDAVRDIL 274 Caenorhabditis e...
EFX90029     224 QHDGYWSDFIDPSSGRPYLGSYTNATLFETDERYRHLGFSIEDLGCCKIIRHGTWGTHAFVGCIFTNAPFDGDALQDVL 302 common water flea
XP_003456271 219 QREGFWADFIDPSSGLAYFGPYTNNTLYETDDRYRHLGFQIEDLGCCKVIRHSLWGTHAFVGTIFTSAPPDTPAMKTLQ 297 Nile tilapia
1_pfamImport 190 QKEGFWADFVDPSSGLAFFGSYTNNTLFETDDRYRHLGFQIEDLGCCRVIRHSLWGTHVFVGTIFTSAPPSSLVMKNLQ 268
CAG01007     207 WTAGYWADFIDPTTGAAFFASASSQTALQTEEGLQHLGFHIEASGSCTVIRHILRGTPMFVGTVFTNAPTHSATIARLQ 285 spotted green pu...
XP_004066619 213 WTAGYWADFINPTTGAAFFASPSSTSTLRPDEQLRHLGFRIEVSGSCTVIRHVLNGSPLFVGTVFTSAPTNSAAIARLQ 291 Japanese medaka
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap