6TX2,6TX1


Conserved Protein Domain Family
DUF2228

?
pfam10228: DUF2228 
Uncharacterized conserved protein (DUF2228)
This is a family of conserved proteins of approximately 700 residues found from worms to humans.
Statistics
?
PSSM-Id: 402022
View PSSM: pfam10228
Aligned: 38 rows
Threshold Bit Score: 259.458
Threshold Setting Gi: 268552501
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6TX2_A         50 LQLVGPYDILAGKHKtK--KKSTGLNFNLHWRFYY--DPPEFQTIIIGDNK-TQYHMGYFRDSPDEFPVYVGINEAKKNc 124 
XP_008192479  230 LELVGPFDVLAGKFK-R--VKRPPEDYLRHWRFYY--DTPELLTVLKGDDS-TGYHIGYFYDSPNEPPQVLVSNHGTKDg 303  red flour beetle
XP_011062524  192 LKLVGPYDILDGKIK-IssSENDKEKYLIHWRYYY--DPPEFQTIVKCDDK-EGLHFGYWRDDAVEKPVFIAKNQANVNg 267  Panamanian le...
6_pfamImport    2 LELVGPFDVLNGAIM-----KCTKETALRHYRYFY--DPPEFQTLLKGDEK-EQLHYGYFRDDPKEFPCCVARNKAAVSp 73  
XP_015782073   54 LLLVGPFDVIDGKLKdEvlDSADPASILCYYRFFY--DVPEFQTVLRDTK--SNFHIGYFRDSPSEMPSMVVSNDPDKSc 129  two-spotted s...
EGD81361       49 IDLVGPCQVLHSVDK------PQTKDLHCWHRHVYnfDPPECMTVAVRHA--TKEHWCYFRDDPSETPVMVVHNKASDGg 120  Salpingoeca r...
EGT37142       65 MKLVGPFRKLMENSD------VTGTDLIMLDREKT--DLPEMQTFM----LtTFGRYAFWRDTPSEKNPVIVFVDLKTIp 132  Caenorhabditi...
EFO93194       64 iVFFGPFRKLKENSD------VNGVELIMLDREQS--DLPEMQTFM----KcGTGRYSFWRDEPSERNPVVMFLDQHTCp 131  Caenorhabditi...
XP_002634233   65 MSFIGPFRVLREGVE------VNGVELIMTDRDET--DLPEMQTFL----KcSHGKFSFWRDTPSEKNPVIVFSDIQGIp 132  Caenorhabditi...
O62291         67 VTLVGPFRKLRGESD------ADGTDLIMLDREMT--DLPEMQTFM----KcSHGRYAFWRDKPNDKKPVIVFMDLKTIp 134  Caenorhabditi...
6TX2_A        125 IIVPNGDNVFAAVKLFLTKKLKEITDk-----KKINLLKNIDEKLTEAARELGYSLEqRTVKMKQRDKKVVTKTFHGAGL 199 
XP_008192479  304 VFTKMGDNIFAAVCSYLGELQQSGDP------FKKMHVGKFLTQLKTKAQKLHLSTSaHSEKIKKRGNKIVAKTFNKIGL 377  red flour beetle
XP_011062524  268 IFEPVAENIFGAVDAYLQNKVKTANP------FEKTSIIRLHSQLKNFAKQHNITLDkNTADMRAREKRVVARTFHKAGI 341  Panamanian le...
6_pfamImport   74 AISCVAGNLFGTVNVHAEEVKGTADI------FRKMQIQKIQSALVKWAKQKKFTLDtVTASIKARRSKVVAKTFNGIGV 147 
XP_015782073  130 IINPLGDNIFSGLLAFCEDLKRRRSEk----dDKKANAEKLSLKIKAYAEKNDIPL--VNNNMKERKKKVVAKTFHGAGI 203  two-spotted s...
EGD81361      121 VYGDAGDSILALLVAECKAA------------DRKRDASELRQKLQDLAKKYNIPLT-LGKAKRKRKAKVNAPTFSGIGI 187  Salpingoeca r...
EGT37142      133 ELSMVGNTVEHAIHHFCGLFAKCQDNgkeakaAASNILEILGDA--KMKKE-------TTRAIKKRQSISVGG-LLGPGI 202  Caenorhabditi...
EFO93194      132 EVTVVGNKVEHAIHHLCMRVSKYQDNtkeikeAISTILDILGDN--AMKDE-------IARVIRNRKRETIVG-IVGPGL 201  Caenorhabditi...
XP_002634233  133 VVTVVGNTVEHAIYGFCNKISKLQDNskevksAIAEILGLLGAQ--KMEKE-------ANQVMKKRKKETITG-VLGPGL 202  Caenorhabditi...
O62291        135 DLSVVGNEIRHAILDFCTRCSKCIDCsakskaANSKIQSFFTPS--KISSE-------VKEVLKHREKTTVRG-ISGPGM 204  Caenorhabditi...
6TX2_A        200 VVPVDkn-----------dVGYRELPETDA--DLKRICKTIVEAA-SDEERLKAFAPI-QEMMTFVQFANDECDYGMGLE 264 
XP_008192479  378 VVPYArk----------tqLGYRELAMGDK--DLMVLLNKLNKAS--PEQKNKYLADL-QPVLTFANIALDECDFGTGVK 442  red flour beetle
XP_011062524  342 VVPYDkk----------tqLGYRDLAATDN--DLQKILKQIEEAD-TPEDRKMPIAKL-DEIVRLATIAADECDFGTCLE 407  Panamanian le...
6_pfamImport  148 VVPYDkk----------tdVGYRPLAVSDD--ELKQILKKIASAN-TNSEQDVAWSKL-QPVITAANIANDECDFGTSLE 213 
XP_015782073  204 VVPFEn------------dVGYRPLPENEQ--NLKKLLKKIADMPeEDRQRSKAYESL-REIVNLTNLANDECDFGMALE 268  two-spotted s...
EGD81361      188 CVPFDed----------teIGYRPLSVSDK--KLRSILDAIVKAK--RKNQTPDYSQL-DLLVQYANISNDEFDFGQALQ 252  Salpingoeca r...
EGT37142      203 YLEQHsng----------sprYRRLLHSRHdpHIENLLRCLTNAK-VKSDEQAVIKLInEEIVGHVIICNDEGDFGNGLE 271  Caenorhabditi...
EFO93194      202 LVGELprg----------gsrYRVMDDAQNp-NIESLLRCLKHVP-FPKQQDTVVDII-DSLMGDFTVYNDEGFYGNGLE 268  Caenorhabditi...
XP_002634233  203 LVGDFpntn---------ksrYRVVSKES---NIENLLRCLSNTG--KQHQDAVIGEI-DELMNNVMMYNDEGFYGNGLE 267  Caenorhabditi...
O62291        205 LIDVVptgnsgkknkknerTGYRDLSKNAYciNIEHLVRSLRLCQ-TKEQEEKVLDFV-YGLMNEINICNDEGDFGNGLE 282  Caenorhabditi...
6TX2_A        265 LGMDLFCYGSHYFHKVAGQLLPLAYNLLKRNLFAEI 300 
XP_008192479  443 LGWELLFHGIDSLNATIAQFLGNSNRLLGREAFAKI 478  red flour beetle
XP_011062524  408 LGHDLFSNGGIHVQTRALQMLSIAYTHLKRPQLLKI 443  Panamanian leafcutter ant
6_pfamImport  214 LGLDMFAFGEESLHATIEQVLCTTYNLLQRNNFADI 249 
XP_015782073  269 LGIDLFCFGEECYHRLVSFTLGTAYELLDRHQFGTI 304  two-spotted spider mite
EGD81361      253 LGLDLYAHSL-IFKTDALHLLAPTYALLQRDVFADI 287  Salpingoeca rosetta
EGT37142      272 LGHVMFLANHKAIEDDLKMILIPAYKFLKRSDFIEI 307  Caenorhabditis brenneri
EFO93194      269 LGHLLFLANHKSVSNQALILLQTAYQLLKRNDFITI 304  Caenorhabditis remanei
XP_002634233  268 LGHVLFLSNQSSISNQVLLVLTTAYNLYGRTDFVNI 303  Caenorhabditis briggsae
O62291        283 LGHILFLANMKAVADPMMITLHIAYKNLHRPDFAKI 318  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap