Conserved Protein Domain Family
WRW

?
pfam10206: WRW 
Mitochondrial F1F0-ATP synthase, subunit f
This is a family of small proteins of approximately 110 amino acids, which are highly conserved from nematodes to humans. Some members of the family have been annotated in Swiss-Prot as being the f subunit of mitochondrial F1F0-ATP synthase but this could not be confirmed. The sequence has a well-conserved WRW motif. The exact function of the protein is not known.
Statistics
?
PSSM-Id: 402005
View PSSM: pfam10206
Aligned: 22 rows
Threshold Bit Score: 133.573
Threshold Setting Gi: 308472187
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003098322  45 EIGLFDKRWNKNVHGPYCHWRYYGKLDTKLMDVKLGELPAWIARRDKTPSAFYNEFMRNVWRVHNLYYSGPvyNNTVKVI 124 Caenorhabditis ...
XP_393421     16 twGCYPEGYNPAEHGPYDPSRYYGKPDTPFGEVKLGELPAWFSRREKGFRAFAALISRAHWRWQLKYIHPR--KANMAPL 93  honey bee
Q4PM56         2 AIGDYPAEYNPKVHGPYDPARYYGKPDTPFSELKLTEIGSWLARRKKSPQSVAGLFSRVYWRWQQKYVLPR--RAGIVGA 79  black-legged tick
Q201W3         2 GIGDYPAEYNPKVHGPYDPARYYGTPDKPFGQLKLGEVTEWVGRRNKSPKAIAGLFSRAYWRWSHKYVQPK--RTTVAPL 79  pea aphid
XP_003240133  29 GIGDYPAEYNPKVHGPYDPARFYGTPSTPFSELKLCEVPQWLKCRNKSAKSLAALFSRAYWRWSHQYVQPK--RTTAAPL 106 pea aphid
ESO00582       1 -IGEYPPEYNPRVHGPYYPSRYYGKADTKFTQVKLGEMGQWLGRRNYDPLSMLRCIGRGWTRWQMKWMMPK--RASIAPV 77  Helobdella robusta
XP_018645245   3 NFGLLPKEYNARVHGVYFPGTYYGKKDIPFGDVQLGQLSEWFSRRSKNPVDMLRAVSRFYWRYAFRWVMTK--RPSVVPF 80  Schistosoma man...
EEB11001      10 sWGEYPPEFNKAVHGYYDPSRYYGKPDTPFTEVKLKDLSSWFSRRQKTPRACLNALNRAYWRFNWHWLLPK--KPGYAGF 87  human body louse
XP_015787248  15 tFNCYPPEYNRAIHGPYDPRINYACKDKGILDVKLNELPSWLMRRRFTPSAIAGVMSRHFYRSCHHHFIAV--RSRSNMF 92  two-spotted spi...
1_pfamImport   1 GFGDYPVEYNPKVHGPYDPARYYGKADTSFGQVKLGELGQWLMRRNKSPNAIIAAISRAHWRWMHKYVHPK--RTSLAPF 78 
XP_003098322 125 FRFIFAYSFLNWLVKSHRYVDFQK 148 Caenorhabditis remanei
XP_393421     94 YQAAFLASAFGYCINYLRLRGHRN 117 honey bee
Q4PM56        80 AQFCVAWSALFYWINYNKLKHERR 103 black-legged tick
Q201W3        80 IHILAGSMLFFYAINYGKFVHHRN 103 pea aphid
XP_003240133 107 IQGLTGMMLIFYIINYGKTIRHRN 130 pea aphid
ESO00582      78 VQFCMGVSLFFYVNNYRr------ 95  Helobdella robusta
XP_018645245  81 FQLTFSFAAFRYFSDYAEHRSHKH 104 Schistosoma mansoni
EEB11001      88 LQMYFGFFLVNYLFSYKALQKHQR 111 human body louse
XP_015787248  93 FTVLLITAAMGYVFQLHNMSHHRR 116 two-spotted spider mite
1_pfamImport  79 MQISCACIAFFYVINYKRMKAERR 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap