Conserved Protein Domain Family
DuoxA

?
pfam10204: DuoxA 
Dual oxidase maturation factor
DuoxA (Dual oxidase maturation factor) is the essential protein necessary for the final release of DUOX2 (an NADPH:O2 oxidoreductase flavoprotein) from the endoplasmic reticulum. Dual oxidases (DUOX1 and DUOX2) constitute the catalytic core of the hydrogen peroxide generator, which generates H2O2 at the apical membrane of thyroid follicular cells, essential for iodination of thyroglobulin by thyroid peroxidases. DuoxA carries five membrane-integral regions including a reverse signal-anchor with external N-terminus (type III) and two N-glycosylation sites. It is conserved from nematodes to humans.
Statistics
?
PSSM-Id: 402003
View PSSM: pfam10204
Aligned: 38 rows
Threshold Bit Score: 296.421
Threshold Setting Gi: 1209685945
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003384065  14 YGENKTPVTEDILEVGLLVAFGMIAFSFILIIPGIRgWERLFATIRVFVTLFIGAVILVSNFGYGWYTDTVRVQTQYKAF 93  Amphimedon quee...
3_pfamImport   2 NVPNRTAVTGDVPCIAACLAFITLYIAFLIIFPGVR-KERFSTFSTVTLSLFAGNVIMVCRMGSSWHIANTKILSPYSAF 80 
XP_001949862  14 GYSNRTPVTGDVQMITTCLVFGTIFTAFLIIFPGVR-KERFTTFTTVTLSLFVGNVILLSILGSSWHVAETVITSAYRAL 92  pea aphid
Q171Q5        18 SFSNRTPVTGDVSIVAVCVLFATIYLAFLVIFPGVR-KQKFTTFTTVTLSLFVGLVILVTRLGSGWHVAQSTIVAPYKAF 96  yellow fever mo...
Q9VJQ7        18 SFSNRTPVTGDVSIVAVSVLFATFYVAFLVIFPGVR-KQKFTTFSTVTLSLFVGLVILITRLGSAWHVAHATIIAPYKAF 96  fruit fly
XP_008191435  18 SFNNRTAVTGDVTLITFLTIFSTLYVAFLIIFPGIR-KERFTTFFAVTLSLFVGATILVTLFGSAWHVATASIVSTYRAF 96  red flour beetle
XP_001607607  18 SYSNRTPVTGDVSLITIFVLFGTVFVAFLLIFPGIR-KERLTTFLTVTLVVFVGMTINVALLGSTWHTSTATIVSSYSAY 96  jewel wasp
XP_011259247  18 SYSNRTPVTGDVPLVIIFVIFGTLFTAFLVIFPGIR-KERLTTFLTVTMSLFVGATIQVAQYGSSWHTSTATIVSSYSAF 96  Florida carpent...
EEB10699      18 SYSNRTPVTGDVNTISIILVFTTLLVAFLVIFPGIR-KERFTTFLSVILSLYIGTVILVANNGSSWHVGVIKIVSTYRAY 96  human body louse
EFX87619      18 DRANRTAVTGDVSTITFCVIAITLFVAFLIVLPGMR-KERFTTFTSVTISLFVGAVILVTGNGCGWHTGEGQITSSYRAF 96  common water flea
XP_003384065  94 TTEEIVADVGLHIGLRGINITLkgQPLDpnGALageTIDYNERFWWAdpwfqgrigfgrYAGRINQEFRAAQYRGMPYPI 173 Amphimedon quee...
3_pfamImport  81 SKELLSAELGAYIGLTHVNITL--LGEQh-WKQ---QIDFNERFTWR------------GSGEMGESYKAGLERGLPFPI 142
XP_001949862  93 SKELITAELGAYVGLGHINITLcaMPSDn-SSVpleDISFNERFSWL------------GAHEMGESYQAALYRGMPFPI 159 pea aphid
Q171Q5        97 SREKLPARLGAHIGLMHINITLaaLPVGn-WSTp--DIDFNERFSWN------------QANDMGNSYKNALQRGLPYPI 161 yellow fever mo...
Q9VJQ7        97 SREKLPARIGTHIGLMHVNVTLtaIPIGn-WTPp--DIDYNERFTWE------------GANDMSANYRHALQRGLPFPI 161 fruit fly
XP_008191435  97 STDKLSSNIGVYVGLRHVNITLqaSGGH----NwtsDIDFNEQFLWI------------NSDQMGDSFREAMVRGLPFPI 160 red flour beetle
XP_001607607  97 SRQRMTAEIGGYIGLMHINITYrvLPE----SAdmgDVEYNERFYWR------------KPHEMTDCFKDALFRGTPFPI 160 jewel wasp
XP_011259247  97 SRHKAMADIGGYIGLMHINITYklLPENe-QTNs--DVEYNERFWWR------------SSGEMTSAFKQALYQGAPFPI 161 Florida carpent...
EEB10699      97 SPDRLHAELGAYIGLDHVNVTLkaLPGVn-RTAe--DIDFNERFQWI------------GSHEMGTSYKQSLKKGLPFPI 161 human body louse
EFX87619      97 SNEKIIAKLGIHIGFNHVNVTLrsAGVFn-LSD---RIDYNERFGWR------------GPDDMVNEYHKALHKGLPYPI 160 common water flea
XP_003384065 174 LWVAEYFTLDGEQIRWARKFRQAGWYAHQYLWLAFAIYLLTILTYLWNIRYGIHLTMLLGIIMIMACGAYGLViLNKPHI 253 Amphimedon quee...
3_pfamImport 143 LTVAEYFTLGQEGFTWGGNYRHAGYYASILLWTAFASWLVMNLLLVVVPRYGACAMVLTGCLMLASTLVYHCL-LPVRPL 221
XP_001949862 160 LTVAEYFSLGQEGFAWGGQYRAAGYYGSIFLWTAFVLWFLMNILLIVVPRYGAYTMIGMGSFMVGATVAYHSM-LPSSPL 238 pea aphid
Q171Q5       162 LTVAEYFSLGQEGFAWGGQYRAAGYYASILLWASFASWLLMNLLLVAVPRYGAYTMTLTGALLIGASIGYSQM-LPKRPL 240 yellow fever mo...
Q9VJQ7       162 LTVAEYFSLGREGFSWGGQYRAAGYFASIMLWASLASWLLMNLLLIAVPRYGAYMKALTGALLVCTTVGYHCL-LPKRPL 240 fruit fly
XP_008191435 161 LTVAEYFTMGQEGLSWGGQYRAAGYYAIIMLWTSFSVWILMNLMLIVVPRYGAVLMTTCGFLLLATACGYFGL-LPETPL 239 red flour beetle
XP_001607607 161 VSLAEYFSLHQEGFSWGGKYREAGYYASVMLWTSFASWSMTGLLLVMVPRYGAYGMVFTGLCMLFTNLTYWSL-LPCDPL 239 jewel wasp
XP_011259247 162 VSLAEYFSLHQEGFSWGSQYREAGYYASIMLWTSFASWLMMNLLLMVVPRYGAYSMILTGLCMLLTNLIYTSL-LPCEPL 240 Florida carpent...
EEB10699     162 LTVAEYLSQCQEGFNWGAHYRAAGYYASVTLWASFASWLMMNLLLIVVPRYGAYAMTTTGTLMLLSDFLYWYM-IPPHEL 240 human body louse
EFX87619     161 LTVAEYLSLNEEGFGWGRTYRQAGYYSCIALWASFAAWLLMNILLVTVPVYGGYMMLLTGGLMLLSNLIYFIN-VPSRPL 239 common water flea
XP_003384065 254 RLPWnqancepnpsageWCAQaMVPHFGWSWGLVLATGILVFIMGVILFIVDFFVPRWTAPLF 316 Amphimedon queenslandica
3_pfamImport 222 HVKF-------------EDTT-LSFRFGWCFWLVVVAGALCILVGLIILTIDLIYPNRFSTIL 270
XP_001949862 239 VIRF-------------QDDKfLLFRLGWCFWLTLFTGLLCISVGLIIVAIDCVYPHKFSTIL 288 pea aphid
Q171Q5       241 TIFI-------------EGGR-ISFRLGWCFWLVLIAGILCLSVGLIISIIDLVWPHRFSTIL 289 yellow fever mosquito
Q9VJQ7       241 SIHL-------------EGGR-LEFHFGWCYWLVLVAGILCFIAGVLISIIDLVWPHTFSTVL 289 fruit fly
XP_008191435 240 VVHI-------------EGST-LHFSFGWCYWLVLIAGSICLLSGVIITVLEIIFPHSFSTIL 288 red flour beetle
XP_001607607 240 VAHV-------------DGSI-LIFNFGWNYWLVLVAGIAFLLAGVVITAIDMIFPHSFSTIL 288 jewel wasp
XP_011259247 241 IAHI-------------DGSI-LSFNFGWNYWLVLSAGAACLLAGIVITAIDMIFPHQFSTIL 289 Florida carpenter ant
EEB10699     241 VVRL-------------EESV-LNFHFGKSFYLVLYSGILCLIVGLIITTIDTIFPHKFTTML 289 human body louse
EFX87619     240 LIRF-------------EDTI-ISFTYGWCFWLVLAAGLLVSLLGLIITLVEIAYPHKFSTVI 288 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap